DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbs and ASPP

DIOPT Version :9

Sequence 1:NP_001246786.1 Gene:Mbs / 49070 FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:NP_788423.1 Gene:ASPP / 37422 FlyBaseID:FBgn0034606 Length:1069 Species:Drosophila melanogaster


Alignment Length:194 Identity:63/194 - (32%)
Similarity:99/194 - (51%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGA 103
            |||:.|....:.|.|.|.|:.:.|.:...|.|:.:.||.:|:||||.|....::|:|:||||.|.
  Fly   858 GRRVSFDPLALLLDASLEGELELVKKTAMQVANPSAANDEGITALHNAICAGHIDIVKFLVEFGC 922

  Fly   104 DINRQDNEGWTPLHATASCGFVSIARYLVENGADV-AAVNSDGD--------------------L 147
            |:|.||::||||||..|||..:|:.::|||:||.: |:..||.:                    .
  Fly   923 DVNAQDSDGWTPLHCAASCNNLSMVKFLVESGACLFASTLSDHETPAEKCEEDEEGFDGCSEYLY 987

  Fly   148 ALDLAIDVQH----MAMIDYMEKMVQELNINVDE----ARKAEELAMLNDAKK---WLRSDAAE 200
            ::...:.:.|    .|:..|..:...||:.:|:|    .||.:      ||:.   |.|:.|.|
  Fly   988 SIQEKLGILHNGDVYAVFSYEAQNGDELSFHVNEPLIVLRKGD------DAENEWWWARNAAGE 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANK 50..164 CDD:238125 46/138 (33%)
Ank_2 53..142 CDD:289560 41/89 (46%)
ANK repeat 78..109 CDD:293786 15/30 (50%)
ANK 106..290 CDD:238125 36/127 (28%)
ANK repeat 111..142 CDD:293786 16/31 (52%)
ANK repeat 209..239 CDD:293786
Ank_2 213..300 CDD:289560
ANK repeat 241..272 CDD:293786
PRKG1_interact 1177..1272 CDD:292521
ASPPNP_788423.1 ANK 867..968 CDD:238125 44/100 (44%)
Ank_2 869..955 CDD:289560 39/85 (46%)
ANK repeat 869..895 CDD:293786 7/25 (28%)
ANK repeat 897..928 CDD:293786 15/30 (50%)
ANK repeat 930..955 CDD:293786 13/24 (54%)
SH3_ASPP 999..1056 CDD:212741 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.