DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbs and Ppp1r16a

DIOPT Version :9

Sequence 1:NP_001246786.1 Gene:Mbs / 49070 FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:NP_001124038.1 Gene:Ppp1r16a / 362944 RGDID:1307962 Length:525 Species:Rattus norvegicus


Alignment Length:470 Identity:157/470 - (33%)
Similarity:223/470 - (47%) Gaps:81/470 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLDARNNSAMMKRAEQLKRWEESDTNRAAPTPRHEHGRR-------------IKFSSGCVFLAAC 54
            |...|...|..:||:|:|.|.:::  :.|...:..||.|             :.|......|.|.
  Rat    18 STQERLKHAQKRRAQQVKMWAQAE--KEAHGNKKGHGERPRKEVAGLKPQKQVHFPPSIALLEAA 80

  Fly    55 LSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHAT 119
            ...|.:||.|.|..|...|.||.||||||||.||||..:||:.|:|.|||:|.:|:|.||||||.
  Rat    81 ARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMVQQLLEAGADVNARDSECWTPLHAA 145

  Fly   120 ASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNI---NVDEARKA 181
            |:||.:.:...|:..|||:.|||:||::..||..|.|   .:||:|..:....|   :::|||..
  Rat   146 ATCGHLHLVELLISRGADLLAVNTDGNMPYDLCEDEQ---TLDYLETAMANRGITQDSIEEARAV 207

  Fly   182 EELAMLNDAKKWLRSDAAEVDRP--HPKTGATALHVAAAKGYTKVLGLLLAGRGNVDRQDNDGWT 244
            .||.||||.:..|.: .|.::.|  |   |||.||:|||.|:::|..|||....::..:|:|||.
  Rat   208 PELCMLNDLQNLLHA-GANLNDPLDH---GATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWE 268

  Fly   245 PLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDV-ADRKI-VKFLE-------ELRANKRNK 300
            |||||::|||....|:||...||::.::...::.:|| .|.:: .|.||       .|||..|.:
  Rat   269 PLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHKQDALLRAQGRQR 333

  Fly   301 ---RRPSSQIRISDAMENHVEKT-PTKLVRVEVRTDATKDAENVKPNQQIHAVE----------- 350
               ||.:|.......:...|..| .|.|.|.|                  ||.|           
  Rat   334 SLLRRRTSSAGSRGKVVRRVSLTHRTNLYRKE------------------HAQEAIVWQQPPVTS 380

  Fly   351 -HPVEEE-----APWRRKLPRTPSDS---PTNNQV---PDRELGTNSSETANDVILRRTQSFEND 403
             .|:|:|     |..|.:.|...|..   |.|.||   |.|.|.:...:.:....|...:|...|
  Rat   381 PEPLEDEDRQTDAELRLQPPEDDSPEVARPHNGQVGAPPGRHLYSKRLDRSVSYHLSPEESCSPD 445

  Fly   404 QKFYQKYNELRARIK 418
            .....|.:...|.:|
  Rat   446 ALIRDKAHHTLAELK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANK 50..164 CDD:238125 56/113 (50%)
Ank_2 53..142 CDD:289560 46/88 (52%)
ANK repeat 78..109 CDD:293786 20/30 (67%)
ANK 106..290 CDD:238125 76/190 (40%)
ANK repeat 111..142 CDD:293786 15/30 (50%)
ANK repeat 209..239 CDD:293786 13/29 (45%)
Ank_2 213..300 CDD:289560 37/95 (39%)
ANK repeat 241..272 CDD:293786 16/30 (53%)
PRKG1_interact 1177..1272 CDD:292521
Ppp1r16aNP_001124038.1 ANK repeat 75..102 CDD:293786 9/26 (35%)
Ank_2 76..168 CDD:289560 47/91 (52%)
ANK 99..286 CDD:238125 90/193 (47%)
ANK repeat 104..135 CDD:293786 20/30 (67%)
ANK repeat 137..168 CDD:293786 15/30 (50%)
Ank_4 205..253 CDD:290365 22/51 (43%)
ANK repeat 232..263 CDD:293786 14/33 (42%)
Ank_2 237..327 CDD:289560 33/89 (37%)
ANK 261..>327 CDD:238125 23/65 (35%)
ANK repeat 265..293 CDD:293786 16/27 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0505
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.