DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mbs and nrarpa

DIOPT Version :9

Sequence 1:	NP_001246786.1	Gene:	Mbs / 49070	FlyBaseID:	FBgn0005536	Length:	1273	Species:	Drosophila melanogaster
Sequence 2:	NP_852472.1	Gene:	nrarpa / 353224	ZFINID:	ZDB-GENE-030515-6	Length:	112	Species:	Danio rerio

Alignment Length:	88	Identity:	35/88 - (39%)
Similarity:	49/88 - (55%)	Gaps:	4/88 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 VFLAACLSGDKDEVVQLLDQGA----DINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQD 109
            ||..|...|:..|:..||....    ::|:...:|.|||||:.||.||::|:.||:.||||...:
Zfish    15 VFQEAVKKGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLAN 79

  Fly   110 NEGWTPLHATASCGFVSIARYLV 132
            .|||:.||..|..|...|..||:
Zfish    80 REGWSALHIAAFGGHQDIVLYLI 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mbs	NP_001246786.1	ANK	50..164	CDD:238125	34/87 (39%)
		Ank_2	53..142	CDD:289560	33/84 (39%)
		ANK repeat	78..109	CDD:293786	17/30 (57%)
		ANK	106..290	CDD:238125	10/27 (37%)
		ANK repeat	111..142	CDD:293786	10/22 (45%)
		ANK repeat	209..239	CDD:293786
		Ank_2	213..300	CDD:289560
		ANK repeat	241..272	CDD:293786
		PRKG1_interact	1177..1272	CDD:292521
nrarpa	NP_852472.1	Ank_2	19..104	CDD:372319	33/84 (39%)
		ANK repeat	48..79	CDD:293786	17/30 (57%)
		ANK 1	48..77		17/28 (61%)
		ANK 2	81..110		10/22 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910