DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbs and PPP1R27

DIOPT Version :10

Sequence 1:NP_001246786.1 Gene:Mbs / 49070 FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:NP_001007534.1 Gene:PPP1R27 / 116729 HGNCID:16813 Length:154 Species:Homo sapiens


Alignment Length:138 Identity:53/138 - (38%)
Similarity:79/138 - (57%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RAAPTPRHEH---GRRIKFSSGCVFLAACLSGDKDEVVQLL-DQGADINTANVDGLTALHQACID 89
            |.:|..|...   .|.::|.:..:||.....||.::|.:.: .:...:.|.:..||.|||:|.:.
Human    10 RYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLS 74

  Fly    90 DNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAID 154
            .||:.|:.||:.||||:::|..||||||...|.|:..|||||:..|||..|.|.||||..|| ||
Human    75 GNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDL-ID 138

  Fly   155 VQHMAMID 162
            ..:..:::
Human   139 PDYKELVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANKYR 50..300 CDD:440430 48/114 (42%)
ANK repeat 78..109 CDD:293786 15/30 (50%)
ANK repeat 111..142 CDD:293786 17/30 (57%)
ANK repeat 209..239 CDD:293786
ANK repeat 241..272 CDD:293786
IPD_PPP1R12 606..648 CDD:412018
PRKG1_interact 1177..1273 CDD:464927
PPP1R27NP_001007534.1 ANKYR <33..>147 CDD:440430 48/115 (42%)
ANK repeat 63..94 CDD:293786 15/30 (50%)
ANK 1 63..92 15/28 (54%)
ANK repeat 96..127 CDD:293786 17/30 (57%)
ANK 2 96..125 16/28 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.