DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbs and LOC101885790

DIOPT Version :9

Sequence 1:NP_001246786.1 Gene:Mbs / 49070 FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:XP_021325568.1 Gene:LOC101885790 / 101885790 -ID:- Length:337 Species:Danio rerio


Alignment Length:239 Identity:66/239 - (27%)
Similarity:115/239 - (48%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 NSTSNSVSATSANHTTATAPNATSNHDDKDND--KENDN---------RTQTVIQRRRKPKRRST 1109
            |...:|...:|........|:..::...|:::  .||||         ..|.:|:....|     
Zfish   110 NPERSSFCMSSVKGACGFTPSLKNHRSLKESEWMDENDNILYGCSGASLAQKLIEDSDLP----- 169

  Fly  1110 GVVHIDMDELDPERQNESSNNDNEEKEKESGSERTSRSRLGSTASTATTSESKSSSSNDKTENGD 1174
            |::         ..|:.:|.:|:      ||.:..| .||.|..||.|..|::.:|.:...|:..
Zfish   170 GLL---------TEQDRASRSDS------SGVDSLS-DRLSSRTSTYTRRENRLASLSKPDEDST 218

  Fly  1175 GIDYKALWEAEKLENDKLRQMLKQKDDEAVQTRATLERFA----NATTKNSLSELEKRERRAMER 1235
            ..|||.|:|....||:||:..|:....|..:.|:.|:|..    ..:.::::.|.||||:.|:|:
Zfish   219 SKDYKKLYEDALSENEKLKSRLEDSKQELTKIRSQLDRVTQKQDRISERSTVFESEKREKEALEK 283

  Fly  1236 KLSELEEELK------QLDAYKSDNHRLKEENAALIRVISKLSK 1273
            ::|::|||||      :|.|.:..|.||..||.|::|.:::||:
Zfish   284 RVSDMEEELKTPPALARLQALRRGNARLLVENKAMLRTLARLSQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANK 50..164 CDD:238125
Ank_2 53..142 CDD:289560
ANK repeat 78..109 CDD:293786
ANK 106..290 CDD:238125
ANK repeat 111..142 CDD:293786
ANK repeat 209..239 CDD:293786
Ank_2 213..300 CDD:289560
ANK repeat 241..272 CDD:293786
PRKG1_interact 1177..1272 CDD:292521 36/104 (35%)
LOC101885790XP_021325568.1 PRKG1_interact 221..326 CDD:318172 36/104 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.