DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and YPK2

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_013822.1 Gene:YPK2 / 855130 SGDID:S000004710 Length:677 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:116/400 - (28%)
Similarity:206/400 - (51%) Gaps:52/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 DDLIAQVRNKLNSGGKDIFAQCVNAVKAFLAGEPFR-EFESS----MYFHRYL------------ 294
            |:::.::..|:|: .:||.....:.        |.. :.:|:    :|.|.::            
Yeast   273 DEVLKEILKKINT-NQDIHLDSFHL--------PLNLKIDSAAQIRLYNHHWISLERGYGKLNIT 328

  Fly   295 -QWKWLEAQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEK 358
             .:|..:.:|::...|.:.:|:|||.||:|...:.:.|.|:||.|.|.|..|..:...:..|.|:
Yeast   329 VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393

  Fly   359 QILQKINSPFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGL 423
            .:|.:::.||:|.|.:::::.:.|.|||..:|||:|.:|:.:.|   .|.|.|:|||.||:.|.|
Yeast   394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEG---RFSLARSRFYIAELLCAL 455

  Fly   424 QHLHKQGIVYRDCKPENILLDDHGHVRISDLGLA-VEIPEGEMVRGRVGTVGYMAPEVIDNEKYA 487
            ..|||..::|||.||||||||..||:.:.|.||. :.:.:.:......||..|:|||::..:.|.
Yeast   456 DSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520

  Fly   488 FSPDWFSFGCLLYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSI 552
            .:.||::.|.|||||:.|..|:......|    :.:::.:.|..:...|:..||.:...||::..
Yeast   521 KTVDWWTLGILLYEMMTGLPPYYDENVPV----MYKKILQQPLLFPDGFDPAAKDLLIGLLSRDP 581

  Fly   553 KQRLGCRNGRMGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVPDPHAVYAKDVLDI----EQFST 613
            .:|||..    |..::..||||  ..::|::|......||:.|     ..|..:|.    ::|:.
Yeast   582 SRRLGVN----GTDEIRNHPFF--KDISWKKLLLKGYIPPYKP-----IVKSEIDTANFDQEFTK 635

  Fly   614 VKGVN--IDE 621
            .|.::  :||
Yeast   636 EKPIDSVVDE 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367 10/74 (14%)
STKc_GRK4_like 308..597 CDD:270756 99/289 (34%)
S_TKc 309..574 CDD:214567 92/265 (35%)
YPK2NP_013822.1 YPK1_N_like 114..339 CDD:212165 10/74 (14%)
PKc_like 349..660 CDD:419665 103/314 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.