DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and S6K2

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:361 Identity:118/361 - (32%)
Similarity:191/361 - (52%) Gaps:52/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPFVVNLA 373
            |.:.:|:|:|.||:|...:.:.|.::||.|.:.|.:|.::.....:..|:.||.||:.||:|.|.
plant   140 FEVLKVVGQGAFGKVYQVRKKDTSEIYAMKVMRKDKIVEKNHAEYMKAERDILTKIDHPFIVQLK 204

  Fly   374 YAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYRDCKP 438
            |:::||..|.|||..:|||.|.|.:|:.|   .|..:.||.|.||:...:.|||::||::||.||
plant   205 YSFQTKYRLYLVLDFINGGHLFFQLYHQG---LFREDLARVYTAEIVSAVSHLHEKGIMHRDLKP 266

  Fly   439 ENILLDDHGHVRISDLGLAVEIPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGCLLYEMI 503
            ||||:|..|||.::|.|||.|..|........||..|||||::..:.:..:.||:|.|.|||||:
plant   267 ENILMDVDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGILLYEML 331

  Fly   504 EGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRMGGQDV 568
            .|:.||...|.|::     :::.:|..|.....::||.::.:.||.|..::|||  :|..|.:::
plant   332 TGKPPFLGSKGKIQ-----QKIVKDKIKLPQFLSNEAHALLKGLLQKEPERRLG--SGPSGAEEI 389

  Fly   569 MAHPFFHSTQLNWRRLEAGMLEPPFVPDPHAVYAKDVLDIEQFSTVKGVNIDESDTNFYTKFNTG 633
            ..|.:|.:  :||::|||..::|.|.|   ||..:..:          .|.|             
plant   390 KKHKWFKA--INWKKLEAREVQPSFKP---AVSGRQCI----------ANFD------------- 426

  Fly   634 SVSISWQNEMMETECFRELNVF-GPEECPTPDLQIN 668
                         :|:.:::|. .|...|..|.:.|
plant   427 -------------KCWTDMSVLDSPASSPNSDAKAN 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 108/287 (38%)
S_TKc 309..574 CDD:214567 99/264 (38%)
S6K2NP_001327294.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.