DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and Rps6ka1

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_006239145.1 Gene:Rps6ka1 / 81771 RGDID:620675 Length:741 Species:Rattus norvegicus


Alignment Length:311 Identity:118/311 - (37%)
Similarity:174/311 - (55%) Gaps:25/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRA-----TGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPF 368
            |.:.:|||:|.||:|..  ||.     .|.:||.|.|:|..:|.| ......:|:.||..:|.||
  Rat    68 FELLKVLGQGSFGKVFL--VRKVTRPDNGHLYAMKVLKKATLKVR-DRVRTKMERDILADVNHPF 129

  Fly   369 VVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVY 433
            ||.|.||::|:..|.|:|..:.||||   ...:..|..|..|..:||.||:|.||.|||..||:|
  Rat   130 VVKLHYAFQTEGKLYLILDFLRGGDL---FTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIY 191

  Fly   434 RDCKPENILLDDHGHVRISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGC 497
            ||.||||||||:.||::::|.||:.| |...:......|||.||||||::.:.:..|.||:|:|.
  Rat   192 RDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHTHSADWWSYGV 256

  Fly   498 LLYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGR 562
            |::||:.|..||:.:..|.....:.:.....|:..|:    ||:|:.:.|..::...|||  :|.
  Rat   257 LMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLST----EAQSLLRALFKRNPANRLG--SGP 315

  Fly   563 MGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVPDPHAVYAKDVLDIEQFST 613
            .|.:::..| .|:|| ::|.:|....::|||.|   ||...|  |...|.|
  Rat   316 DGAEEIKRH-IFYST-IDWNKLYRREIKPPFKP---AVAQPD--DTFYFDT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 112/293 (38%)
S_TKc 309..574 CDD:214567 103/270 (38%)
Rps6ka1XP_006239145.1 S_TKc 68..326 CDD:214567 103/270 (38%)
STKc_RSK_N 72..388 CDD:270734 117/307 (38%)
STKc_RSK1_C 422..712 CDD:271077
Pkinase 424..681 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.