DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gprk2 and cnih2

DIOPT Version :9

Sequence 1:	NP_001263143.1	Gene:	Gprk2 / 49045	FlyBaseID:	FBgn0261988	Length:	714	Species:	Drosophila melanogaster
Sequence 2:	NP_001072219.1	Gene:	cnih2 / 779666	XenbaseID:	XB-GENE-952875	Length:	162	Species:	Xenopus tropicalis

Alignment Length:	47	Identity:	14/47 - (29%)
Similarity:	22/47 - (46%)	Gaps:	5/47 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   617 VNIDESDTNFYTKFNTGSVSISWQN-EMMETEC--FRELNVFGPEEC 660
            :..||..|:|......|:.|.:.:. :.:|..|  .|:|.|  ||.|
Frog    29 IAFDELRTDFKNPIEQGNPSRARERVKNVERICCLLRKLVV--PEYC 73

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gprk2	NP_001263143.1	RGS	35..>111	CDD:295367
		RGS	<248..305	CDD:295367
		STKc_GRK4_like	308..597	CDD:270756
		S_TKc	309..574	CDD:214567
cnih2	NP_001072219.1	Cornichon	8..151	CDD:367442	14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165172886
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930