powered by:
Protein Alignment Gprk2 and cnih2
DIOPT Version :9
Sequence 1: | NP_001263143.1 |
Gene: | Gprk2 / 49045 |
FlyBaseID: | FBgn0261988 |
Length: | 714 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072219.1 |
Gene: | cnih2 / 779666 |
XenbaseID: | XB-GENE-952875 |
Length: | 162 |
Species: | Xenopus tropicalis |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 22/47 - (46%) |
Gaps: | 5/47 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 617 VNIDESDTNFYTKFNTGSVSISWQN-EMMETEC--FRELNVFGPEEC 660
:..||..|:|......|:.|.:.:. :.:|..| .|:|.| ||.|
Frog 29 IAFDELRTDFKNPIEQGNPSRARERVKNVERICCLLRKLVV--PEYC 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165172886 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.