DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and RPS6KA3

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_011543857.1 Gene:RPS6KA3 / 6197 HGNCID:10432 Length:746 Species:Homo sapiens


Alignment Length:298 Identity:108/298 - (36%)
Similarity:165/298 - (55%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRATG----KMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPFV 369
            |.:.:|||:|.||:|...: :.:|    ::||.|.|:|..:|.| ......:|:.||.::|.||:
Human    68 FELLKVLGQGSFGKVFLVK-KISGSDARQLYAMKVLKKATLKVR-DRVRTKMERDILVEVNHPFI 130

  Fly   370 VNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYR 434
            |.|.||::|:..|.|:|..:.||||   ...:..|..|..|..:||.||:|..|.|||..||:||
Human   131 VKLHYAFQTEGKLYLILDFLRGGDL---FTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYR 192

  Fly   435 DCKPENILLDDHGHVRISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGCL 498
            |.||||||||:.||::::|.||:.| |...:......|||.||||||::...:..|.||:|||.|
Human   193 DLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVL 257

  Fly   499 LYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRL------G 557
            ::||:.|..||:.:..|.....:.:.....|:..|    .||:|:.:.|..::...||      |
Human   258 MFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLS----PEAQSLLRMLFKRNPANRLVNPFLIG 318

  Fly   558 CRNGRMGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVP 595
            .  |..|.:::..|.||  :.::|.:|....:.|||.|
Human   319 A--GPDGVEEIKRHSFF--STIDWNKLYRREIHPPFKP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 108/298 (36%)
S_TKc 309..574 CDD:214567 100/275 (36%)
RPS6KA3XP_011543857.1 S_TKc 68..333 CDD:214567 100/275 (36%)
STKc_RSK_N 72..394 CDD:270734 107/294 (36%)
STKc_RSK2_C 408..737 CDD:271078
Pkinase 428..685 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.