DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and sgk2b

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_009290615.1 Gene:sgk2b / 559050 ZFINID:ZDB-GENE-060929-44 Length:409 Species:Danio rerio


Alignment Length:294 Identity:115/294 - (39%)
Similarity:164/294 - (55%) Gaps:24/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQK-INSPFVVNL 372
            |...:|:|.|.||:|.....|..||.||.|.|:|..|..||.|..|:.|.::|.| :|.||:|.|
Zfish    82 FDYLKVIGTGSFGKVFLATHRENGKYYAVKVLQKHIILTRKEERNVMCEHRVLLKTLNHPFLVKL 146

  Fly   373 AYAYETKDALCLVLTIMNGGDLKFHIYNMG--GEPGFELERARFYAAEVACGLQHLHKQGIVYRD 435
            .::::||:.|.|||....||:|.:|:...|  ||     .||||||||:||.|.:||...|||||
Zfish   147 HFSFQTKERLYLVLDYACGGELFYHLQREGVFGE-----ARARFYAAEMACALGYLHSLKIVYRD 206

  Fly   436 CKPENILLDDHGHVRISDLGLAVEIPEGEMVRGRV----GTVGYMAPEVIDNEKYAFSPDWFSFG 496
            .||||||||..|||.::|.||.   .||...||..    ||..|:||||:..|:|..:.||:..|
Zfish   207 LKPENILLDSAGHVVLTDFGLC---KEGMSGRGTTRTFCGTPEYLAPEVLLQEEYDRTVDWWGLG 268

  Fly   497 CLLYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNG 561
            .:|:||:.|..||    ....|.|:.|.:...|....:..:..|:.:.::||.:...:|||.:..
Zfish   269 AVLHEMLYGLPPF----YNADRLEMLRNIIYQPLALKAGVSSAARDLLKRLLNRDRAKRLGAKRD 329

  Fly   562 RMGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVP 595
            .:   ::.:|.||  :.:.|..|.|..::||:||
Zfish   330 LI---ELQSHAFF--SPIQWDELVAKKIQPPYVP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 115/294 (39%)
S_TKc 309..574 CDD:214567 106/271 (39%)
sgk2bXP_009290615.1 S_TKc 82..339 CDD:214567 106/271 (39%)
PKc_like 86..398 CDD:304357 114/290 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.