DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and Rps6ka3

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_017457618.1 Gene:Rps6ka3 / 501560 RGDID:1563860 Length:759 Species:Rattus norvegicus


Alignment Length:292 Identity:108/292 - (36%)
Similarity:165/292 - (56%) Gaps:18/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRATG----KMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPFV 369
            |.:.:|||:|.||:|...: :.:|    ::||.|.|:|..:|.| ......:|:.||.::|.||:
  Rat    87 FELLKVLGQGSFGKVFLVK-KISGSDARQLYAMKVLKKATLKVR-DRVRTKMERDILVEVNHPFI 149

  Fly   370 VNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYR 434
            |.|.||::|:..|.|:|..:.||||   ...:..|..|..|..:||.||:|..|.|||..||:||
  Rat   150 VKLHYAFQTEGKLYLILDFLRGGDL---FTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYR 211

  Fly   435 DCKPENILLDDHGHVRISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGCL 498
            |.||||||||:.||::::|.||:.| |...:......|||.||||||::...:..|.||:|||.|
  Rat   212 DLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVL 276

  Fly   499 LYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRM 563
            ::||:.|..||:.:..|.....:.:.....|:..|    .||:|:.:.|..::...|||.  |..
  Rat   277 MFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLS----PEAQSLLRMLFKRNPANRLGA--GPD 335

  Fly   564 GGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVP 595
            |.:::..|.||  :.::|.:|....:.|||.|
  Rat   336 GVEEIKRHSFF--STIDWNKLYRREIHPPFKP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 108/292 (37%)
S_TKc 309..574 CDD:214567 100/269 (37%)
Rps6ka3XP_017457618.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.