DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gprk2 and AgaP_AGAP012025

DIOPT Version :9

Sequence 1:	NP_001263143.1	Gene:	Gprk2 / 49045	FlyBaseID:	FBgn0261988	Length:	714	Species:	Drosophila melanogaster
Sequence 2:	XP_552199.2	Gene:	AgaP_AGAP012025 / 3291484	VectorBaseID:	AGAP012025	Length:	50	Species:	Anopheles gambiae

Alignment Length:	45	Identity:	13/45 - (28%)
Similarity:	27/45 - (60%)	Gaps:	5/45 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 LKDKLDISYGYVIDQQPIGRELFRLFCEN--KRPVYFRYITFLDE 87
            |:.:.::::..:.: |.:|..|||.||:|  :.||  .::.|.:|
Mosquito     9 LEKENEVNFDKIFN-QVLGYLLFRDFCDNVSEEPV--PHLKFYEE 50

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gprk2	NP_001263143.1	RGS	35..>111	CDD:295367	13/45 (29%)
		RGS	<248..305	CDD:295367
		STKc_GRK4_like	308..597	CDD:270756
		S_TKc	309..574	CDD:214567
AgaP_AGAP012025	XP_552199.2	RGS	1..>50	CDD:295367	12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910