DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and AgaP_AGAP012025

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_552199.2 Gene:AgaP_AGAP012025 / 3291484 VectorBaseID:AGAP012025 Length:50 Species:Anopheles gambiae


Alignment Length:45 Identity:13/45 - (28%)
Similarity:27/45 - (60%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LKDKLDISYGYVIDQQPIGRELFRLFCEN--KRPVYFRYITFLDE 87
            |:.:.::::..:.: |.:|..|||.||:|  :.||  .::.|.:|
Mosquito     9 LEKENEVNFDKIFN-QVLGYLLFRDFCDNVSEEPV--PHLKFYEE 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367 13/45 (29%)
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756
S_TKc 309..574 CDD:214567
AgaP_AGAP012025XP_552199.2 RGS 1..>50 CDD:295367 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.