DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and sgk1

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_005162356.1 Gene:sgk1 / 324140 ZFINID:ZDB-GENE-030131-2860 Length:598 Species:Danio rerio


Alignment Length:374 Identity:122/374 - (32%)
Similarity:171/374 - (45%) Gaps:71/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 FRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQK-INSPFVVNL 372
            |...:|:|||.||:|...:.|:..|.||.|.|:||.|.|:|.|..::.|:.:|.| :..||:|.|
Zfish   265 FDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGL 329

  Fly   373 AYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYRDCK 437
            .|:::|.|.|..||..:|||:|.:|:..   |..|...||||||||:|..|.:||...|||||.|
Zfish   330 HYSFQTTDKLYFVLDYINGGELFYHLQR---ERCFLEPRARFYAAEIASALGYLHSLNIVYRDLK 391

  Fly   438 PENILLDDHGHVRISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGCLLYE 501
            |||||||..||:.::|.||..| |..........||..|:||||:..:.|..:.||:..|.:|||
Zfish   392 PENILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYE 456

  Fly   502 MIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRMGGQ 566
            |:.|..||..|    ...|:...:...|.:.....::.|:.:.:.||.|...:|||..:   ...
Zfish   457 MLYGLPPFYSR----NTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGFTD---DFT 514

  Fly   567 DVMAHPFFHSTQLNWRRLEAGMLEPPFVPDPHAVYAKDVLDIEQFSTVKGVNIDESDTNFYTKFN 631
            ::..|.||  :.:||..|.|..|.|||.|                                    
Zfish   515 EIKNHMFF--SPINWDDLNAKKLTPPFNP------------------------------------ 541

  Fly   632 TGSVSISWQNEMMETECFRELNVFGPEECPTPDLQINAAPEPDKAGCFP 680
                                 ||.||.:....|.:....|.|:..||.|
Zfish   542 ---------------------NVTGPNDLRHFDPEFTDEPVPNSIGCSP 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367
STKc_GRK4_like 308..597 CDD:270756 112/289 (39%)
S_TKc 309..574 CDD:214567 101/266 (38%)
sgk1XP_005162356.1 STKc_SGK1 257..595 CDD:270753 122/374 (33%)
S_TKc 265..522 CDD:214567 101/266 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.