DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and Rps6ka6

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001178650.1 Gene:Rps6ka6 / 317203 RGDID:1560817 Length:860 Species:Rattus norvegicus


Alignment Length:344 Identity:118/344 - (34%)
Similarity:188/344 - (54%) Gaps:39/344 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 VNAVKAFLAGEPFREFE----------SSMYFHRYLQWKWLEAQPITYKTFRMYRVLGKGGFGEV 323
            ||.:|  :..||..|.|          ..:...::::..:.:|.|   ..|.:.:|||:|.||:|
  Rat   145 VNDLK--MVDEPMDEGEPVFCRREDLVKEIPITQHVKEGYEKADP---AQFDLLKVLGQGSFGKV 204

  Fly   324 CACQVRA---TGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPFVVNLAYAYETKDALCLV 385
            ...:.:.   .|::||.|.|.|..:|.| ......:|:.||.::|.||:|.|.||::|:..|.|:
  Rat   205 FLVRKKTGPDAGQLYAMKVLRKASLKVR-DRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLI 268

  Fly   386 LTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYRDCKPENILLDDHGHVR 450
            |..:.|||:   ...:..|..|..|..:||.||:|..|.|||:.||||||.||||||||:.||::
  Rat   269 LDFLRGGDV---FTRLSKEVLFTEEDVKFYLAELALALDHLHRLGIVYRDLKPENILLDEIGHIK 330

  Fly   451 ISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGCLLYEMIEGQAPFRMRKE 514
            ::|.||:.| :.:.:......|||.||||||::...::.|.||:|:|.|::||:.|..||   :.
  Rat   331 LTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEMLTGTLPF---QG 392

  Fly   515 KVKREEVDRRVKED---PEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRMGGQDVMAHPFFHS 576
            |.:.|.::..:|..   |:..|:    ||:|:.:.|..::...|||..    |.::|..|.||.|
  Rat   393 KDRNETMNMILKAKLGMPQFLSA----EAQSLLRMLFKRNPANRLGSE----GVEEVKRHAFFSS 449

  Fly   577 TQLNWRRLEAGMLEPPFVP 595
              ::|.:|....::|||.|
  Rat   450 --IDWNKLYKREVQPPFRP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367 9/45 (20%)
STKc_GRK4_like 308..597 CDD:270756 109/295 (37%)
S_TKc 309..574 CDD:214567 100/271 (37%)
Rps6ka6NP_001178650.1 S_TKc 190..447 CDD:214567 100/271 (37%)
STKc_RSK_N 194..508 CDD:270734 108/290 (37%)
STKc_RSK_C 543..829 CDD:270993
Pkinase 543..800 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.