DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and Prkaca

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001094392.1 Gene:Prkaca / 25636 RGDID:3389 Length:351 Species:Rattus norvegicus


Alignment Length:393 Identity:110/393 - (27%)
Similarity:189/393 - (48%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 AVKAFL--AGEPFREFESSMYFHRYLQWKWLEAQPITYKTFRMYRVLGKGGFGEVCACQVRATGK 333
            :||.||  |.|.|.:           :|:...........|...:.||.|.||.|...:.:.:|.
  Rat    15 SVKEFLAKAKEDFLK-----------KWETPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGN 68

  Fly   334 MYACKKLEKKRIKKRKGESMVLIEKQILQKINSPFVVNLAYAYETKDALCLVLTIMNGGDLKFHI 398
            .||.|.|:|:::.|.|.....|.||:|||.:|.||:|.|.::::....|.:|:..:.||::..|:
  Rat    69 HYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHL 133

  Fly   399 YNMG--GEPGFELERARFYAAEVACGLQHLHKQGIVYRDCKPENILLDDHGHVRISDLGLAVEIP 461
            ..:|  .||     .||||||::....::||...::|||.||||:|:|..|:::::|.|.|    
  Rat   134 RRIGRFSEP-----HARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA---- 189

  Fly   462 EGEMVRGRV----GTVGYMAPEVIDNEKYAFSPDWFSFGCLLYEMIEGQAPFRMRKEKVKREEVD 522
              :.|:||.    ||..|:|||:|.::.|..:.||::.|.|:|||..|..|| ...:.:   ::.
  Rat   190 --KRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPF-FADQPI---QIY 248

  Fly   523 RRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRMGGQDVMAHPFFHSTQLNWRRLEAG 587
            .::.....::.|.|:.:.|.:.:.||...:.:|.|  |.:.|..|:..|.:|.:|  :|..:...
  Rat   249 EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFG--NLKNGVNDIKNHKWFATT--DWIAIYQR 309

  Fly   588 MLEPPFVPDPHAVYAKDVLDIEQFSTVKGVNIDESDTNFYTKFNTGSVSISWQNEMMETECFREL 652
            .:|.||:|                 ..||    ..||:.:..:....:.:|     :..:|.:|.
  Rat   310 KVEAPFIP-----------------KFKG----PGDTSNFDDYEEEEIRVS-----INEKCGKEF 348

  Fly   653 NVF 655
            ..|
  Rat   349 TEF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367 8/35 (23%)
STKc_GRK4_like 308..597 CDD:270756 94/294 (32%)
S_TKc 309..574 CDD:214567 87/270 (32%)
PrkacaNP_001094392.1 PTZ00426 16..334 CDD:173616 106/368 (29%)
STKc_PKA 42..331 CDD:271111 98/328 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.