DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and Akt2

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_008757330.1 Gene:Akt2 / 25233 RGDID:2082 Length:496 Species:Rattus norvegicus


Alignment Length:342 Identity:119/342 - (34%)
Similarity:179/342 - (52%) Gaps:44/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 ITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSPF 368
            :|...|...::||||.||:|...:.:|||:.||.|.|.|:.|..:...:..:.|.::||....||
  Rat   162 VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPF 226

  Fly   369 VVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVY 433
            :..|.||::|.|.||.|:...|||:|.||   :..|..|..:|||||.||:...|::||.:.:||
  Rat   227 LTALKYAFQTHDRLCFVMEYANGGELFFH---LSRERVFTEDRARFYGAEIVSALEYLHSRDVVY 288

  Fly   434 RDCKPENILLDDHGHVRISDLGLAVE-IPEGEMVRGRVGTVGYMAPEVIDNEKYAFSPDWFSFGC 497
            ||.|.||::||..||::|:|.||..| |.:|..::...||..|:||||:::..|..:.||:..|.
  Rat   289 RDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGV 353

  Fly   498 LLYEMIEGQAPFRMRK-----EKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLG 557
            ::|||:.|:.||..:.     |.:..||:         ::......||||:...||.|..|||||
  Rat   354 VMYEMMCGRLPFYNQDHERLFELILMEEI---------RFPRTLGPEAKSLLAGLLKKDPKQRLG 409

  Fly   558 CRNGRMGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVPDPHAVYAKDVLDIEQFSTVKGVNIDES 622
              .|....::||.|.||.|  :||:.:....|.|||.|..                     ..|.
  Rat   410 --GGPSDAKEVMEHRFFLS--INWQDVVQKKLLPPFKPQV---------------------TSEV 449

  Fly   623 DTNFY-TKFNTGSVSIS 638
            ||.:: .:|...|::|:
  Rat   450 DTRYFDDEFTAQSITIT 466

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367