DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and grk-2

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_497235.2 Gene:grk-2 / 175223 WormBaseID:WBGene00001709 Length:707 Species:Caenorhabditis elegans


Alignment Length:392 Identity:160/392 - (40%)
Similarity:234/392 - (59%) Gaps:17/392 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 DIFAQCVNAVKAFLAGEPFREFESSMYFHRYLQWKWLEA-QPITYKTFRMYRVLGKGGFGEVCAC 326
            |:|.:.|..:...|.|:.|:.|..|..|.|:.|||.||. ..:|...|.::|::|:||||||..|
 Worm   144 DLFHRYVLEICDQLRGDIFQRFLESDKFTRFCQWKNLELNMQL
TMNDFSVHRIIGRGGFGEVYGC 208

  Fly   327 QVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINS----PFVVNLAYAYETKDALCLVLT 387
            :...||||||.|.|:|||||.::||::.|.|:.:|..:::    ||:|.:.||:::.|.||.:|.
 Worm   209 RKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGQDCPFIVCMTYAFQSPDKLCFILD 273

  Fly   388 IMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQGIVYRDCKPENILLDDHGHVRIS 452
            :||||||.:|:...|   .|..:...|||:||..||:|:|.:.:||||.||.|||||::||||:|
 Worm   274 LMNGGDLHYHLSQHG---VFTEQEMIFYASEVILGLEHMHNRFVVYRDLKPANILLDENGHVRVS 335

  Fly   453 DLGLAVEIPEGEMVRGRVGTVGYMAPEVI-DNEKYAFSPDWFSFGCLLYEMIEGQAPFRMRKEKV 516
            |||||.:..: :.....|||.|||||||: ....|..|.||||.||:||::::|.:|||..|.|.
 Worm   336 DLGLACDYSK-KKPHASVGTHGYMAPEVLAKGVAYDSSADWFSLGCMLYKLLKGHSPFRQHKSKD 399

  Fly   517 KREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGCRNGRMGGQDVMAHPFFHSTQLNW 581
            |.|.....:.:|.|..:...:.:.:.:.:.||.:.:..|||||.  .|..:|..||||  ..::|
 Worm   400 KNEIDKMTLTQDIELPNEGLSKDCRDLLEGLLKRDVPDRLGCRG--KGPTEVKEHPFF--KDVDW 460

  Fly   582 RRLEAGMLEPPFVPDPHAVYAKDVLDIEQF--STVKGVNIDESDTNFYTKFNTGSVSISWQNEMM 644
            :.:....:.||.:|....|.|.|..||..|  ..||||.:.:.|::.|..||. .:|..||||:.
 Worm   461 QTVYLRRMTPPLIPPRGEVNAADAFDIGNFDDDEVKGVKLQDGDSDLYKNFNI-VISERWQNEIA 524

  Fly   645 ET 646
            ||
 Worm   525 ET 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367 15/42 (36%)
STKc_GRK4_like 308..597 CDD:270756 123/293 (42%)
S_TKc 309..574 CDD:214567 117/269 (43%)
grk-2NP_497235.2 RGS_GRK2_GRK3 30..186 CDD:188701 15/41 (37%)
Pkinase 191..455 CDD:278497 117/269 (43%)
STKc_beta_ARK 196..475 CDD:270757 120/286 (42%)
S_TK_X 456..530 CDD:214529 25/72 (35%)
PH_GRK2_subgroup 553..676 CDD:269946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0986
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1104340at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.