DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk2 and SGK2

DIOPT Version :9

Sequence 1:NP_001263143.1 Gene:Gprk2 / 49045 FlyBaseID:FBgn0261988 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001186193.1 Gene:SGK2 / 10110 HGNCID:13900 Length:367 Species:Homo sapiens


Alignment Length:298 Identity:114/298 - (38%)
Similarity:162/298 - (54%) Gaps:17/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 AQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQK-I 364
            |||   ..|...:|:|||.:|:|...:.::.|..||.|.|:||.|.|:|.:|.::.|:.:|.| :
Human    30 AQP---TDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNV 91

  Fly   365 NSPFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFELERARFYAAEVACGLQHLHKQ 429
            ..||:|.|.|:::|.:.|..||..:|||:|.||:..   |..|...||||||||||..:.:||..
Human    92 RHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQR---ERRFLEPRARFYAAEVASAIGYLHSL 153

  Fly   430 GIVYRDCKPENILLDDHGHVRISDLGLAVEIPEGEMVRGR-VGTVGYMAPEVIDNEKYAFSPDWF 493
            .|:|||.||||||||..|||.::|.||..|..|.|..... .||..|:||||:..|.|..:.||:
Human   154 NIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWW 218

  Fly   494 SFGCLLYEMIEGQAPFRMRKEKVKREEVDRRVKEDPEKYSSKFNDEAKSMCQQLLAKSIKQRLGC 558
            ..|.:||||:.|..||..:..    .::...:...|.:........|..:.|.||.|..:||||.
Human   219 CLGAVLYEMLHGLPPFYSQDV----SQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGS 279

  Fly   559 RNGRMGGQDVMAHPFFHSTQLNWRRLEAGMLEPPFVPD 596
            :...:   ::..|.||  :.:||..|....|.|||.|:
Human   280 KADFL---EIKNHVFF--SPINWDDLYHKRLTPPFNPN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk2NP_001263143.1 RGS 35..>111 CDD:295367
RGS <248..305 CDD:295367 3/3 (100%)
STKc_GRK4_like 308..597 CDD:270756 111/291 (38%)
S_TKc 309..574 CDD:214567 101/266 (38%)
SGK2NP_001186193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_SGK2 39..359 CDD:270754 110/286 (38%)
Nuclear localization signal. /evidence=ECO:0000250 68..78 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.