DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gprk2 and klhl17

DIOPT Version :9

Sequence 1:	NP_001263143.1	Gene:	Gprk2 / 49045	FlyBaseID:	FBgn0261988	Length:	714	Species:	Drosophila melanogaster
Sequence 2:	XP_004916201.1	Gene:	klhl17 / 100491332	XenbaseID:	XB-GENE-977875	Length:	627	Species:	Xenopus tropicalis

Alignment Length:	161	Identity:	31/161 - (19%)
Similarity:	50/161 - (31%)	Gaps:	51/161 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   248 DLIAQVRNKLNSGGKDIFAQCVNAVKAFLAGEPFREFESSMYFHRYLQWKWLEAQPITYKTFRMY 312
            |::..|..|...|.|.:.|.|.....|....|.....::.:..|        :..|...:....|
Frog    78 DIVLHVGTKEIKGHKVVLASCSPYFHAMFTNEMSESRQTHVTLH--------DIDPQALEQLVQY 134

  Fly   313 R-----VLGKG---------------GFGEVCACQ-------------VRATGKMYACKKLEKKR 344
            .     |:|:|               |..:.| |:             :|.....::|..|.|..
Frog   135 AYTAEIVVGEGNVQTLLPAASLLQLNGVRDAC-CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSA 198

  Fly   345 IK---------KRKGESMVLIEKQILQKINS 366
            .|         .:..|.|:|..||:|..|:|
Frog   199 HKYVLQHFVEVSKTEEFMLLPLKQVLDLISS 229

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gprk2	NP_001263143.1	RGS	35..>111	CDD:295367
		RGS	<248..305	CDD:295367	11/56 (20%)
		STKc_GRK4_like	308..597	CDD:270756	20/101 (20%)
		S_TKc	309..574	CDD:214567	20/100 (20%)
klhl17	XP_004916201.1	BTB_POZ_KLHL17_actinfilin	38..176	CDD:349555	18/106 (17%)
		PHA03098	77..543	CDD:222983	31/161 (19%)
		KELCH repeat	321..360	CDD:276965
		KELCH repeat	364..407	CDD:276965
		KELCH repeat	411..454	CDD:276965
		KELCH repeat	458..502	CDD:276965
		KELCH repeat	505..549	CDD:276965
		KELCH repeat	552..597	CDD:276965
		Kelch	564..608	CDD:128874
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165172885
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24355
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.030