DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boca and AT2G46000

DIOPT Version :9

Sequence 1:NP_724578.1 Gene:boca / 48986 FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_566061.1 Gene:AT2G46000 / 819208 AraportID:AT2G46000 Length:208 Species:Arabidopsis thaliana


Alignment Length:172 Identity:46/172 - (26%)
Similarity:75/172 - (43%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLE---DDELPEHLRPQPK 70
            |:.|..|:|...|....:.|.|.|...:.|: ||:.:.|. ||||...|   ....||.   .|.
plant    10 LILLVGLLLFMNFHGFVRIAEATKRRIEISD-DLDDVEDN-EEDESWKEWGKKATTPEF---DPP 69

  Fly    71 LDLSNLD-SKSPEDLLKVSKKGRTLMTFVSV-TGNP-TREESDTITKLWQTSLWNNHIQAERYMV 132
            .|.:|:. .:..|::.|  :...|::.||.: .|.| |::....|...|...|....|......|
plant    70 PDFTNMGFDQIQEEMAK--RTFGTVVGFVKLRLGVPRTKDVVIDIAMKWTKVLRTGGIGVRFMAV 132

  Fly   133 DDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEY--PG 172
            |.:..:|..::|....:.::|::.||....|.|..:|:  ||
plant   133 DRSTVMFNMQNGKLVTELREFVLSQEEAYEVKIGKQEFRRPG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 39/150 (26%)
AT2G46000NP_566061.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.