DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boca and srg-69

DIOPT Version :9

Sequence 1:NP_724578.1 Gene:boca / 48986 FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001364743.1 Gene:srg-69 / 353477 WormBaseID:WBGene00005226 Length:342 Species:Caenorhabditis elegans


Alignment Length:40 Identity:11/40 - (27%)
Similarity:16/40 - (40%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLE 43
            ||.:|:..|.||:.          .|.....:.|:|.|.|
 Worm   139 RLFVLVGFLIPLIF----------MWFMIPCKSYAELDSE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 4/13 (31%)
srg-69NP_001364743.1 Srg 18..293 CDD:396614 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4357
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590303at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.