powered by:
Protein Alignment boca and srg-69
DIOPT Version :9
Sequence 1: | NP_724578.1 |
Gene: | boca / 48986 |
FlyBaseID: | FBgn0004132 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001364743.1 |
Gene: | srg-69 / 353477 |
WormBaseID: | WBGene00005226 |
Length: | 342 |
Species: | Caenorhabditis elegans |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 16/40 - (40%) |
Gaps: | 10/40 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 RLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLE 43
||.:|:..|.||:. .|.....:.|:|.|.|
Worm 139 RLFVLVGFLIPLIF----------MWFMIPCKSYAELDSE 168
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
boca | NP_724578.1 |
Mesd |
31..178 |
CDD:287194 |
4/13 (31%) |
srg-69 | NP_001364743.1 |
Srg |
18..293 |
CDD:396614 |
11/40 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4357 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1590303at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.