DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boca and Mesd

DIOPT Version :9

Sequence 1:NP_724578.1 Gene:boca / 48986 FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001008346.1 Gene:Mesd / 308796 RGDID:1310344 Length:224 Species:Rattus norvegicus


Alignment Length:177 Identity:84/177 - (47%)
Similarity:122/177 - (68%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLVLLLLALTPLVLAKKFK--------EEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDE 60
            |.|||.|..:.|:|....:        |...|...|||||||::||:.|||:|||:|:: :|:.:
  Rat     8 RAVLLFLCASDLLLLSPPEAYATDTPGEAITPPRKKKDIRDYNDADMARLLEQWEKDDD-IEEGD 71

  Fly    61 LPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHI 125
            ||||.||...:|.|.||...||.:||::|||:|||.||:::||||.:|::.||.|||.||:|.:.
  Rat    72 LPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTISGNPTEKETEEITSLWQGSLFNANY 136

  Fly   126 QAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG 172
            ..:|::|..:||||:.:||:.||:.||||:.|:||..||:|.:.|||
  Rat   137 DVQRFIVGSDRAIFMLRDGSYAWEIKDFLVNQDRCAEVTLEGQMYPG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 75/142 (53%)
MesdNP_001008346.1 Chaperone domain. /evidence=ECO:0000250|UniProtKB:Q9ERE7 1..155 67/147 (46%)
Mesd 43..192 CDD:401992 75/142 (53%)
Escort domain. /evidence=ECO:0000250|UniProtKB:Q9ERE7 156..195 15/28 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..224 3/6 (50%)
Prevents secretion from ER 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353899
Domainoid 1 1.000 172 1.000 Domainoid score I3637
eggNOG 1 0.900 - - E1_KOG4357
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11347
Inparanoid 1 1.050 174 1.000 Inparanoid score I3982
OMA 1 1.010 - - QHG45813
OrthoDB 1 1.010 - - D1590303at2759
OrthoFinder 1 1.000 - - FOG0007230
OrthoInspector 1 1.000 - - oto98128
orthoMCL 1 0.900 - - OOG6_107397
Panther 1 1.100 - - LDO PTHR17600
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5334
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.