DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boca and bmy-1

DIOPT Version :9

Sequence 1:NP_724578.1 Gene:boca / 48986 FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_495003.2 Gene:bmy-1 / 173908 WormBaseID:WBGene00017293 Length:186 Species:Caenorhabditis elegans


Alignment Length:186 Identity:83/186 - (44%)
Similarity:124/186 - (66%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEE-DEEPLEDDELPEH 64
            |:.|.|.:.|....:.|| ..|::      |||:..|::|:||:|.::||| ||:.||:||.|||
 Worm     1 MKWRTVFIFLLAAHIGLA-NVKQK------KKDLSSYTDAELEKLYEEWEENDEDELEEDEKPEH 58

  Fly    65 LRPQPKLDLSNLDSKS--PEDLLKVSKKGRTLMTFVSVT--GNPTREE----SDTITKLWQTSLW 121
            .|..|:|||.::.:|:  |||||.:||||:|||.||.|.  ..|.|.:    ::..|::||:.|:
 Worm    59 KRKPPQLDLESMKAKAKDPEDLLMMSKKGQTLMLFVGVVDPSQPDRSDIRPFTEKWTQIWQSQLY 123

  Fly   122 NNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKK 177
            |||:..:.:::|||||||:||:|.||::||.||::||....||||.:.:.| .|||
 Worm   124 NNHVDLQVFVIDDNRAIFMFKNGEQAFEAKKFLLKQEFVSEVTIEGQSFDG-PAKK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 76/156 (49%)
bmy-1NP_495003.2 Mesd 24..186 CDD:287194 76/156 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167365
Domainoid 1 1.000 146 1.000 Domainoid score I2807
eggNOG 1 0.900 - - E1_KOG4357
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11347
Inparanoid 1 1.050 146 1.000 Inparanoid score I3017
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45813
OrthoDB 1 1.010 - - D1590303at2759
OrthoFinder 1 1.000 - - FOG0007230
OrthoInspector 1 1.000 - - oto19631
orthoMCL 1 0.900 - - OOG6_107397
Panther 1 1.100 - - LDO PTHR17600
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4085
SonicParanoid 1 1.000 - - X5334
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.