DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boca and mesd

DIOPT Version :9

Sequence 1:NP_724578.1 Gene:boca / 48986 FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002932283.1 Gene:mesd / 100135217 XenbaseID:XB-GENE-940834 Length:212 Species:Xenopus tropicalis


Alignment Length:172 Identity:85/172 - (49%)
Similarity:122/172 - (70%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHL 65
            |..|:|.|.|.|  ||......||:|.  .|||||||::||:.|||:|||:|:: :|:.::|||.
 Frog     4 MGLRVVCLCLVL--LVGLTAAAEEKKK--KKKDIRDYNDADMARLLEQWEQDDD-IEEGDMPEHR 63

  Fly    66 RPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERY 130
            ||...:|.|.:|.|:||.:||::|||:|||.|.:|:|.||.:|::.||.|||.||:|.:...:|:
 Frog    64 RPPAPVDFSKIDPKNPEGVLKMTKKGKTLMIFATVSGEPTEKETEEITSLWQGSLFNANYDIQRF 128

  Fly   131 MVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG 172
            :|..||.||:.:||:.||:.||||:.||||..||:|.:.|||
 Frog   129 IVGSNRVIFMLRDGSYAWEVKDFLVGQERCADVTVEGQVYPG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 74/142 (52%)
mesdXP_002932283.1 Mesd 32..180 CDD:370866 72/140 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3742
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11347
Inparanoid 1 1.050 173 1.000 Inparanoid score I3973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590303at2759
OrthoFinder 1 1.000 - - FOG0007230
OrthoInspector 1 1.000 - - oto104815
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4085
SonicParanoid 1 1.000 - - X5334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.