DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and MAP3K13

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001229243.1 Gene:MAP3K13 / 9175 HGNCID:6852 Length:966 Species:Homo sapiens


Alignment Length:462 Identity:128/462 - (27%)
Similarity:197/462 - (42%) Gaps:115/462 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGT 185
            |.|:|:...|.      :||     ..|..|:|:    |.|.|..:||:       |.|.:...|
Human    53 RTELIESVHSP------VTT-----TVLTSVSED----SRDQFENSVLQ-------LREHDESET 95

  Fly   186 FLVRPSEHNPNGYSLS------VKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAY 244
            .:.:.:.:..:|.|.|      ::....|.|            :||:.                 
Human    96 AVSQGNSNTVDGESTSGTEDIKIQFSRSGSG------------SGGFL----------------- 131

  Fly   245 SKENALGLCHILSRPCPKPQPQMW---------DLGPELRDKYEIPRSEIQLLRKLGRGNFGEVF 300
              |...|        |.:|   :|         |...:.:|.:|:|..||..|:.||.|..|.||
Human   132 --EGLFG--------CLRP---VWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQGAVF 183

  Fly   301 YGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSL 365
            .||:| :.:||:|.:||...:....|      :|.:|..::|...||:|.....|:.||.:.|.|
Human   184 LGKFR-AEEVAIKKVREQNETDIKHL------RKLKHPNIIAFKGVCTQAPCYCIIMEYCAHGQL 241

  Fly   366 LDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVI 430
            .:.||.  ||.:....|:..:|.:||||.||...::|||||.:.|||:...:..||.|||.::.:
Human   242 YEVLRA--GRKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGTSKEL 304

  Fly   431 ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENI- 494
            :|..  .|......|.|.|||.|.....|.|.|:||:|::|.||.| |::||..:.|..:|..: 
Human   305 SDKS--TKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLT-GEIPYKDVDSSAIIWGVG 366

  Fly   495 ERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTF-EFLNH---------------YFESFSVT 543
            .....:|.|:.  .||....|:.|.|.:.|..||:| :.|.|               ||:     
Human   367 SNSLHLPVPST--CPDGFKILMKQTWQSKPRNRPSFRQTLMHLDIASADVLATPQETYFK----- 424

  Fly   544 SEVPYRE 550
            |:..:||
Human   425 SQAEWRE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 7/28 (25%)
SH2_Src_family 158..259 CDD:199827 17/106 (16%)
STYKc 285..537 CDD:214568 89/268 (33%)
PTKc_Src_like 289..538 CDD:270630 88/265 (33%)
MAP3K13NP_001229243.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..114 4/23 (17%)
STYKc 168..402 CDD:214568 87/247 (35%)
STKc_MAP3K12_13 174..410 CDD:270961 87/249 (35%)
Leucine-zipper 1 433..454
Leucine-zipper 2 486..507
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 744..834
Acidic. /evidence=ECO:0000305 815..828
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 846..908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.