powered by:
Protein Alignment Src64B and PIN3
DIOPT Version :9
Sequence 1: | NP_001286937.1 |
Gene: | Src64B / 48973 |
FlyBaseID: | FBgn0262733 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015480.1 |
Gene: | PIN3 / 856277 |
SGDID: | S000006358 |
Length: | 215 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 32/68 - (47%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 PRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPL 148
|...|.......|: .|.|||.:..:.:.||....||::::::....:|:: .....:.|:.|.
Yeast 44 PANAPRNASPASLE-YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYK--GSCNGRTGIFPA 105
Fly 149 NFV 151
|:|
Yeast 106 NYV 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000006 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.