DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and LSB1

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:42/198 - (21%)
Similarity:70/198 - (35%) Gaps:79/198 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFV--AEERSVNSEDW 162
            |.||||::::.:.|||...||:::|::....||:|  ..:..:.|:.|.|:|  |..||.:.:  
Yeast    58 VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYR--GKSNNKIGIFPANYVKPAFTRSASPK-- 118

  Fly   163 FFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYY 227
                           :.|....:.:.|||...|:                             |.
Yeast   119 ---------------SAEAASSSTVSRPSVPPPS-----------------------------YE 139

  Fly   228 IATNQTFPSLQALVMAYSKENALGLCHILSRP---------CPKPQPQMWDL--GPELRDKYEIP 281
            .|.:| :||.|                 :|.|         .|.||.|...|  .|...:.|:.|
Yeast   140 PAASQ-YPSQQ-----------------VSAPYAPPAGYMQAPPPQQQQAPLPYPPPFTNYYQQP 186

  Fly   282 RSE 284
            :.:
Yeast   187 QQQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 16/49 (33%)
SH2_Src_family 158..259 CDD:199827 12/100 (12%)
STYKc 285..537 CDD:214568 42/198 (21%)
PTKc_Src_like 289..538 CDD:270630
LSB1NP_011652.1 SH3 55..108 CDD:214620 17/51 (33%)
PRK14971 <100..>156 CDD:237874 20/119 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.