Sequence 1: | NP_001286937.1 | Gene: | Src64B / 48973 | FlyBaseID: | FBgn0262733 | Length: | 553 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011652.1 | Gene: | LSB1 / 853037 | SGDID: | S000003368 | Length: | 241 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 70/198 - (35%) | Gaps: | 79/198 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 VVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFV--AEERSVNSEDW 162
Fly 163 FFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYY 227
Fly 228 IATNQTFPSLQALVMAYSKENALGLCHILSRP---------CPKPQPQMWDL--GPELRDKYEIP 281
Fly 282 RSE 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Src64B | NP_001286937.1 | SH3_Src_like | 99..150 | CDD:212779 | 16/49 (33%) |
SH2_Src_family | 158..259 | CDD:199827 | 12/100 (12%) | ||
STYKc | 285..537 | CDD:214568 | 42/198 (21%) | ||
PTKc_Src_like | 289..538 | CDD:270630 | |||
LSB1 | NP_011652.1 | SH3 | 55..108 | CDD:214620 | 17/51 (33%) |
PRK14971 | <100..>156 | CDD:237874 | 20/119 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |