DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and AT5G66710

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_201472.1 Gene:AT5G66710 / 836804 AraportID:AT5G66710 Length:405 Species:Arabidopsis thaliana


Alignment Length:269 Identity:76/269 - (28%)
Similarity:124/269 - (46%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAA------FLQEAAIMKKFRHNRLVALYAVCSQ 349
            :|.|:...|:.|.:|..:.|:||..:....|..:      |.:|..::.||||..:|.....|. 
plant    77 IGEGSSSTVYRGLFRRVVPVSVKIFQPKRTSALSIEQRKKFQREVLLLSKFRHENIVRFIGACI- 140

  Fly   350 EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLI- 413
            |..:.|:.|.|...:|..|:.....:.|..:..|..|..:|.|||:|.:..:|||||...|:|: 
plant   141 EPKLMIITELMEGNTLQKFMLSVRPKPLDLKLSISFALDIARGMEFLNANGIIHRDLKPSNMLLT 205

  Fly   414 GENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSI--------KSDVWSYGIL 470
            |:....|:.||||||.........:.|:   .:|.|||...|....|        |.||:|:.|:
plant   206 GDQKHVKLADFGLAREETKGFMTFEAGT---YRWMAPELFSYDTLEIGEKKHYDHKVDVYSFAIV 267

  Fly   471 LMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNH 535
            ..||.| .:.|:.|.::..|.....:..|   |:....|:.:..:|..||...|:.||.|:.:  
plant   268 FWELLT-NKTPFKGKNNIFVAYAASKNQR---PSVENLPEGVVSILQSCWAENPDARPEFKEI-- 326

  Fly   536 YFESFSVTS 544
               ::|:|:
plant   327 ---TYSLTN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 74/260 (28%)
PTKc_Src_like 289..538 CDD:270630 74/261 (28%)
AT5G66710NP_201472.1 STYKc 71..326 CDD:214568 74/256 (29%)
STKc_MAP3K-like 77..330 CDD:270901 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.