DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and STY17

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_195303.2 Gene:STY17 / 829731 AraportID:AT4G35780 Length:570 Species:Arabidopsis thaliana


Alignment Length:352 Identity:106/352 - (30%)
Similarity:175/352 - (49%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 SLQALVM-AYSKENALGLCHILSR--------PCPKPQ---------------PQMWDLGPELRD 276
            ||...|: .:|:|...||...|.:        ||.|.:               |...::..:..|
plant   219 SLDVFVVDGWSQEETEGLKDALKKEIRKFKDQPCSKQKSITFFEHDKSTNELLPACVEIPTDGTD 283

  Fly   277 KYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMST---AAFLQEAAIMKKFRHN 338
            ::||...::::.:|:..|::||:|.|.: .|.:||:|.|:...::.   ..|.||..||:|.||.
plant   284 EWEIDMKQLKIEKKVACGSYGELFRGTY-CSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHK 347

  Fly   339 RLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIH 403
            .:|.....|::...:.||.|:|::||:.|||.:..|.: ..:.|:.:|..|:.||.||....:||
plant   348 NVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVF-KIQSLLKVALDVSKGMNYLHQNNIIH 411

  Fly   404 RDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYG 468
            |||...|:|:.|:.|.|:.|||:|||..:......:...:  :|.|||.|.:..:..::||:||.
plant   412 RDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTY--RWMAPEVIEHKPYDHRADVFSYA 474

  Fly   469 ILLMELFTYGQVPYPGMHS-REVIENIERGFR--MPKPTNHYFPDNIYQLLLQCWDAVPEKRPTF 530
            |:|.||.| |::||..:.. :..:..:::|.|  :||.|:    ..:.:||.:||...|..||.|
plant   475 IVLWELLT-GELPYSYLTPLQAAVGVVQKGLRPKIPKETH----PKLTELLEKCWQQDPALRPNF 534

  Fly   531 ----EFLNHYFESFSVTSEVPYREVQD 553
                |.||...           |||.|
plant   535 AEIIEMLNQLI-----------REVGD 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 8/31 (26%)
STYKc 285..537 CDD:214568 87/261 (33%)
PTKc_Src_like 289..538 CDD:270630 87/258 (34%)
STY17NP_195303.2 ACT_TyrKc 178..244 CDD:153200 8/24 (33%)
STKc_MAP3K-like 301..541 CDD:270901 84/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.