DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and AT4G31170

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001031758.1 Gene:AT4G31170 / 829245 AraportID:AT4G31170 Length:412 Species:Arabidopsis thaliana


Alignment Length:404 Identity:109/404 - (26%)
Similarity:174/404 - (43%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQ------ 238
            |||:.......:.:|.|.|....:|:....|           :.|     ||.:..|:|      
plant     3 ENPKFDLHAVGNHNNDNNYYAFTQDFYQKLG-----------EEG-----TNMSVDSMQTSNAGG 51

  Fly   239 ALVMAYSKENALGLCHILSRPCPKPQPQMWDLGP------------ELRD----------KYE-- 279
            ::.|:....:......::..|..||....:.|..            .|.|          ||.  
plant    52 SVSMSVDNSSVGSSDALIGHPGLKPMRHPYSLSDGQSVFRPGKVTHALNDDALAQALMDSKYPTE 116

  Fly   280 --IPRSEIQL-LRKL------GRGNFGEVFYGKWRNSIDVAVKTLREGTMS-------TAAFLQE 328
              :...|..: ||||      .:|.||:::.|.: |..|||:|.|.....:       ...|.||
plant   117 GLVNYEEWTIDLRKLHMGPAFAQGAFGKLYRGTY-NGEDVAIKLLERSDSNPEKAQALEQQFQQE 180

  Fly   329 AAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGM 393
            .:::...:|..:|.....|.:.....||.||...||:..||.:...|.:..:..:..|..||.||
plant   181 VSMLAFLKHPNIVRFIGACIKPMVWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALDVARGM 245

  Fly   394 EYLESKQLIHRDLAARNVLIGENNVAKICDFGLARV-IADDEYCPKQGSRFPVKWTAPEAIIYGK 457
            .|:..:..|||||.:.|:||..:...||.|||:||: :..:...|:.|:   .:|.|||.|.:..
plant   246 AYVHERNFIHRDLKSDNLLISADRSIKIADFGVARIEVQTEGMTPETGT---YRWMAPEMIQHRP 307

  Fly   458 FSIKSDVWSYGILLMELFTYGQVPYPGMHS-REVIENIERGFRMPKPTNHYFPDNIYQLLLQCWD 521
            ::.|.||:|:||:|.||.| |.:|:..|.: :.....:.||.|...|.: ..| .:.:::.:|||
plant   308 YTQKVDVYSFGIVLWELIT-GLLPFQNMTAVQAAFAVVNRGVRPTVPAD-CLP-VLGEIMTRCWD 369

  Fly   522 AVPEKRPTF-EFLN 534
            |.||.||.| |.:|
plant   370 ADPEVRPCFAEIVN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 14/84 (17%)
STYKc 285..537 CDD:214568 86/267 (32%)
PTKc_Src_like 289..538 CDD:270630 85/262 (32%)
AT4G31170NP_001031758.1 STKc_MAP3K-like 138..385 CDD:270901 82/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.