DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and AT3G50720

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_190641.1 Gene:AT3G50720 / 824236 AraportID:AT3G50720 Length:377 Species:Arabidopsis thaliana


Alignment Length:276 Identity:78/276 - (28%)
Similarity:127/276 - (46%) Gaps:28/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 EIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAA------FLQEAAIMKKFRH 337
            :|.|.|:     :|.|....|:.|:.:|.:.||||.::.|..|..:      |.:|..::...:|
plant    47 DIMRGEM-----IGEGGNSIVYKGRLKNIVPVAVKIVQPGKTSAVSIQDKQQFQKEVLVLSSMKH 106

  Fly   338 NRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLI 402
            ..:|.....|. |..:.||.|.:..|:|..|:.......|..:..:..|..::..||||.||.:|
plant   107 ENIVRFVGACI-EPQLMIVTELVRGGTLQRFMLNSRPSPLDLKVSLSFALDISRAMEYLHSKGII 170

  Fly   403 HRDLAARNVLI-GENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEA-----IIYGK---F 458
            ||||..||||: |:....|:.||||||.........:.|:   .:|.|||.     :..|:   :
plant   171 HRDLNPRNVLVTGDMKHVKLADFGLAREKTLGGMTCEAGT---YRWMAPEVCSREPLRIGEKKHY 232

  Fly   459 SIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAV 523
            ..|.||:|:.::...|.| .:.|:..:.|..:...:.:|.|   |:....||.:..:|..||.|.
plant   233 DQKIDVYSFALIFWSLLT-NKTPFSEIPSISIPYFVNQGKR---PSLSNIPDEVVPILECCWAAD 293

  Fly   524 PEKRPTFEFLNHYFES 539
            .:.|..|:.:....||
plant   294 SKTRLEFKDITISLES 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 73/266 (27%)
PTKc_Src_like 289..538 CDD:270630 73/263 (28%)
AT3G50720NP_190641.1 STKc_MAP3K-like 54..304 CDD:270901 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.