DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and ATN1

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_189393.1 Gene:ATN1 / 822378 AraportID:AT3G27560 Length:356 Species:Arabidopsis thaliana


Alignment Length:296 Identity:80/296 - (27%)
Similarity:134/296 - (45%) Gaps:30/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 ELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREG------TMSTAAFLQEAAI 331
            ||..|:.:....:.:..|:|.|...:|:.||:||. .||:|.::.|      ......|.:|.|:
plant    14 ELDPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQ-TVAIKIIKRGESPEEIAKRDNRFAREIAM 77

  Fly   332 MKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYL 396
            :.|.:|..||.....| :|..:.||.|.:..|:|..:|.....:.|.....:..|..:|..||.|
plant    78 LSKVQHKNLVKFIGAC-KEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIARAMECL 141

  Fly   397 ESKQLIHRDLAARN-VLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSI 460
            .|..:|||||...| :|..::...|:.||||||..:..|....:...:  :|.|||  :|...::
plant   142 HSHGIIHRDLKPENLILSADHKTVKLADFGLAREESLTEMMTAETGTY--RWMAPE--LYSTVTL 202

  Fly   461 ----------KSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQL 515
                      |.|.:|:.|:|.||. ..::|:.||.:.:..  ....|:..:|:....|.::..:
plant   203 RQGEKKHYNHKVDAYSFAIVLWELI-LNKLPFEGMSNLQAA--YAAAFKNLRPSAEDLPGDLEMI 264

  Fly   516 LLQCWDAVPEKRPTF----EFLNHYFESFSVTSEVP 547
            :..||...|.:||.|    :.|..|..:.|....:|
plant   265 VTSCWKEDPNERPNFTEIIQMLLRYLTTVSAPQIIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 74/272 (27%)
PTKc_Src_like 289..538 CDD:270630 75/269 (28%)
ATN1NP_189393.1 STKc_MAP3K-like 32..286 CDD:270901 72/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.