DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and AT2G24360

DIOPT Version :10

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_565568.1 Gene:AT2G24360 / 816972 AraportID:AT2G24360 Length:411 Species:Arabidopsis thaliana


Alignment Length:107 Identity:22/107 - (20%)
Similarity:37/107 - (34%) Gaps:43/107 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WGWKDIIP--QLPALIHAFQTSEMNTPKMRRLCK------FTALPEAMNNIGDR-------SDVY 59
            :.|:.:.|  .|||               .::|.      |.:|.:..|.|...       :|.:
plant  1882 FNWRLVFPFDYLPA---------------EQVCSVSRKEHFWSLDKTENKIPPNLIIQIWDNDKF 1931

  Fly    60 SFRIFLGTI------------ITVKVSYETLDRL-TARHTSL 88
            ||..:||::            ...|...:.||.: :|.|.||
plant  1932 SFDDYLGSVQLDLNRMPRPAKTAEKCRLDLLDEVESANHCSL 1973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH2_Src_family 158..259 CDD:199827
PTKc_Src_like 289..538 CDD:270630
SH3_Src_like 99..150 CDD:212779
AT2G24360NP_565568.1 STKc_MAP3K-like 137..384 CDD:270901
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.