DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and MAP3K12

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001180440.1 Gene:MAP3K12 / 7786 HGNCID:6851 Length:892 Species:Homo sapiens


Alignment Length:294 Identity:96/294 - (32%)
Similarity:150/294 - (51%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 DKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAI--MKKFRHN 338
            |.:|:|..||..|:.:|.|..|.||.|::... :||||.:|:        |:|..|  ::|.:|.
Human   149 DLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE-EVAVKKVRD--------LKETDIKHLRKLKHP 204

  Fly   339 RLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIH 403
            .::....||:|.....|:.|:.::|.|.:.||.  ||.:....|:..:..:|.||.||...::||
Human   205 NIITFKGVCTQAPCYCILMEFCAQGQLYEVLRA--GRPVTPSLLVDWSMGIAGGMNYLHLHKIIH 267

  Fly   404 RDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYG 468
            |||.:.|:||..::|.||.|||.::.::|..  .|......|.|.|||.|.....|.|.|:||:|
Human   268 RDLKSPNMLITYDDVVKISDFGTSKELSDKS--TKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFG 330

  Fly   469 ILLMELFTYGQVPYPGMHSREVIENI-ERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTF-E 531
            ::|.||.| |::||..:.|..:|..: .....:|.|::  .||....||.|||::.|..||:| :
Human   331 VVLWELLT-GEIPYKDVDSSAIIWGVGSNSLHLPVPSS--CPDGFKILLRQCWNSKPRNRPSFRQ 392

  Fly   532 FLNH---------------YFESFSVTSEVPYRE 550
            .|.|               ||:     |:..:||
Human   393 ILLHLDIASADVLSTPQETYFK-----SQAEWRE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 87/270 (32%)
PTKc_Src_like 289..538 CDD:270630 86/267 (32%)
MAP3K12NP_001180440.1 STKc_MAP3K12_13 164..400 CDD:270961 85/251 (34%)
TyrKc 165..397 CDD:197581 84/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.