DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Sla2

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_011238147.1 Gene:Sla2 / 77799 MGIID:1925049 Length:274 Species:Mus musculus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:121/268 - (45%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GSLDSR---YTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSF 116
            |||.||   .:|.|:..|              |...|..:.....|...|||..:.:.:::.||.
Mouse     2 GSLSSRGKTSSPSPSSSG--------------PDQEPVSMQPERHKVTAVALGSFPAGEQARLSL 52

  Fly   117 MKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEEN 181
            ..|:.:.:|.: :.|||.|.:..:.:|..:|..:||:.    :..|.:|.:.|::|::|||...|
Mouse    53 RLGEPLTIISE-DGDWWTVQSEVSGREYHMPSVYVAKV----AHGWLYEGLSREKAEELLLLPGN 112

  Fly   182 PRGTFLVRPSE---------------HNPNGYSLSVK-----DWEDGRGYHVKHYRIKPLDNGGY 226
            |.|.||:|.|:               .:...|||||:     .|:     .::||||:.||||..
Mouse   113 PGGAFLIRESQTRRGLSLYLDPPWTLSSLGCYSLSVRLSRPASWD-----RIRHYRIQRLDNGWL 172

  Fly   227 YIATNQTFPSLQALVMAYSKENALGLCHILSRPC------PKPQPQMWDLGPELRDKYEIPRSEI 285
            ||:...|||||.|||..|| |.|.|:|..|..||      |.|       |.:......:|.|.:
Mouse   173 YISPRLTFPSLHALVEHYS-ELADGICCPLREPCVLQKLGPLP-------GKDTPPPVTVPTSSL 229

  Fly   286 QLLRKLGR 293
            . .:||.|
Mouse   230 N-WKKLDR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 13/50 (26%)
SH2_Src_family 158..259 CDD:199827 45/120 (38%)
STYKc 285..537 CDD:214568 3/9 (33%)
PTKc_Src_like 289..538 CDD:270630 3/5 (60%)
Sla2XP_011238147.1 SH3 35..89 CDD:388381 15/54 (28%)
SH2 82..200 CDD:387587 47/127 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.