DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and TEC

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_003206.2 Gene:TEC / 7006 HGNCID:11719 Length:631 Species:Homo sapiens


Alignment Length:452 Identity:180/452 - (39%)
Similarity:261/452 - (57%) Gaps:32/452 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSE- 160
            :.:|||:||:::.:..||...:|....:::..:..|||..: ....||.||.|:|..::|.|.: 
Human   181 EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARD-KYGNEGYIPSNYVTGKKSNNLDQ 244

  Fly   161 -DWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRG------YHVKHYRI 218
             :|:..|:.|.:|::||.:|:. .|.|:||.|. .|..|::|:.....|.|      ||:|....
Human   245 YEWYCRNMNRSKAEQLLRSEDK-EGGFMVRDSS-QPGLYTVSLYTKFGGEGSSGFRHYHIKETTT 307

  Fly   219 KPLDNGGYYIATNQTFPSLQALVMAYSKENALGLCHILSRPCP---KPQPQMWDLGPELRDKYEI 280
            .|..   ||:|....|.|:..:: .|.|.||.||...|..|..   |..|.......|   |:||
Human   308 SPKK---YYLAEKHAFGSIPEII-EYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYE---KWEI 365

  Fly   281 PRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYA 345
            ..||:..:|:||.|.||.|..||||....||:|.:|||.|....|::||.:|.|..|.:||.||.
Human   366 NPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYG 430

  Fly   346 VCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHF--EDLIYIATQVASGMEYLESKQLIHRDLAA 408
            ||:|::|||||.|:|.:|.||:|||:..|   ||  :.|:.:...|..||||||....|||||||
Human   431 VCTQQKPIYIVTEFMERGCLLNFLRQRQG---HFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAA 492

  Fly   409 RNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLME 473
            ||.|:.|..|.|:.|||:||.:.||:|....|::|||||..||...|.:||.||||||:|:|:.|
Human   493 RNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWE 557

  Fly   474 LFTYGQVPYPGMHSREVIENIERGFRM--PKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFL 533
            :||.|::|:....:.||:..:.||.|:  ||..::|    :|:::|:||...||.||:||.|
Human   558 VFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNY----VYEVMLRCWQEKPEGRPSFEDL 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 15/50 (30%)
SH2_Src_family 158..259 CDD:199827 34/108 (31%)
STYKc 285..537 CDD:214568 119/253 (47%)
PTKc_Src_like 289..538 CDD:270630 119/249 (48%)
TECNP_003206.2 PH_Btk 7..148 CDD:269944
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178
SH3_Tec 182..237 CDD:212838 17/55 (31%)
SH2_Tec_Itk 240..346 CDD:198259 35/111 (32%)
PTKc_Tec_Rlk 365..624 CDD:270685 122/258 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.