DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and SLA

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_006739.2 Gene:SLA / 6503 HGNCID:10902 Length:316 Species:Homo sapiens


Alignment Length:213 Identity:78/213 - (36%)
Similarity:102/213 - (47%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GQKHNNGGSLDSRYTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDES 112
            |:|...|.|:.|  ||.|..               ||...|.|:....|    ..|.||.|.|.|
Human    36 GKKKEMGNSMKS--TPAPAE---------------RPLPNPEGLDSDFL----AVLSDYPSPDIS 79

  Fly   113 DLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLL 177
            ...|.:|:::.||.| |..||:.::|:|.:|..||...||..    ...|.||.:.|.:|::||.
Human    80 PPIFRRGEKLRVISD-EGGWWKAISLSTGRESYIPGICVARV----YHGWLFEGLGRDKAEELLQ 139

  Fly   178 AEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVM 242
            ..:...|:|::|.||.....|||||      |...||||||..|.|..|||:...||..|:.||.
Human   140 LPDTKVGSFMIRESETKKGFYSLSV------RHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVN 198

  Fly   243 AYSKENALGLCHILSRPC 260
            .|| |.|.|||.:|:.||
Human   199 HYS-EVADGLCCVLTTPC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 19/50 (38%)
SH2_Src_family 158..259 CDD:199827 42/100 (42%)
STYKc 285..537 CDD:214568
PTKc_Src_like 289..538 CDD:270630
SLANP_006739.2 SH3_SLAP 66..120 CDD:212943 22/58 (38%)
SH2_SLAP 113..210 CDD:198207 44/107 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.