DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and si:ch211-45c16.2

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_017213349.1 Gene:si:ch211-45c16.2 / 568412 ZFINID:ZDB-GENE-081105-15 Length:982 Species:Danio rerio


Alignment Length:416 Identity:122/416 - (29%)
Similarity:181/416 - (43%) Gaps:95/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KLLLAEENPRGTF---------LVRPSEHNPNGYSLSVKDWED-------GRG------------ 210
            :|.:.:|.|.||.         ..|...|..|.. |.:::.||       |:|            
Zfish    84 QLPVRDEEPGGTSPPCTALSEDSTREQGHFENSV-LQLQEQEDAETPGSCGQGGCGSGGEEKNEE 147

  Fly   211 ------------YHVKHYRIK------PLDNGGYYIATNQTF----PSLQALVMAYSKENALGLC 253
                        :|..|..||      ...:||:   ....|    |....:...||.|..|   
Zfish   148 NGCPMEHSGDDTHHHPHDDIKLHFHRAGTGSGGF---LEGLFGCLRPVWNIIGKTYSTEYKL--- 206

  Fly   254 HILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREG 318
                    :.|.:||          |:|..||..|:.||.|..|.||.||:| |.:||:|.:|| 
Zfish   207 --------QQQVEMW----------EVPFEEISELQWLGSGAQGAVFLGKFR-SEEVAIKKVRE- 251

  Fly   319 TMSTAAFLQEAAI--MKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFED 381
                   .:|..|  ::|.:|..:::...||:|.....|:.||.::|.|.:.||.  ||.:....
Zfish   252 -------QKETDIKHLRKLKHPNIISFKGVCTQAPCYCIIMEYCAQGQLYEVLRA--GRKITPCL 307

  Fly   382 LIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVK 446
            |:..|:.:||||.||...::|||||.:.|||:.:|:..||.|||.::.::|..  .|......|.
Zfish   308 LVDWASGIASGMNYLHLHKIIHRDLKSPNVLVTQNDSVKISDFGTSKELSDKS--TKMSFAGTVA 370

  Fly   447 WTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENI-ERGFRMPKPTNHYFPD 510
            |.|||.|.....|.|.|:||:|::|.||.| |::||..:.|..:|..: .....:|.|:.  .||
Zfish   371 WMAPEVIRNEPVSEKVDIWSFGVVLWELLT-GEIPYKDVDSSAIIWGVGSNSLHLPVPST--CPD 432

  Fly   511 NIYQLLLQCWDAVPEKRPTF-EFLNH 535
            ....|:.|.|...|..||:| :.|.|
Zfish   433 GFKILMKQTWQGKPRNRPSFRQILLH 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 25/134 (19%)
STYKc 285..537 CDD:214568 91/255 (36%)
PTKc_Src_like 289..538 CDD:270630 89/251 (35%)
si:ch211-45c16.2XP_017213349.1 STKc_MAP3K12_13 226..462 CDD:270961 89/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.