DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and csk

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001071067.1 Gene:csk / 556454 ZFINID:ZDB-GENE-061103-493 Length:450 Species:Danio rerio


Alignment Length:479 Identity:179/479 - (37%)
Similarity:269/479 - (56%) Gaps:50/479 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDRMEVIDDT-ESDWWRVVNLTTRQEGLIPLN 149
            |.|.|..       .||.|::....:.||...|||.:.::..| :.:|:|..|...| ||.||.|
Zfish     7 TWPAGTE-------CVARYNFPGTADQDLPMCKGDVLTIVGVTKDPNWYRAKNSAGR-EGTIPAN 63

  Fly   150 FVAEERSVNSED------WFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDG 208
            :|.:...|.|..      ||...:.|::|::||...|.  |.||||.|.:.|..|:|.|..  ||
Zfish    64 YVQKREGVKSASKLSLMPWFHGKITREQAERLLYPPET--GLFLVRESTNYPGDYTLCVSC--DG 124

  Fly   209 RGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKENALGLCHILSRPCPKPQPQMWDLGPE 273
            :   |:|||| ...||...|...:.|.:|..|:..|:|: |.|||..|.:      |::.:....
Zfish   125 K---VEHYRI-IYHNGKLSIDEEEYFENLMQLMEHYTKD-ADGLCTRLIK------PKIMEGTVA 178

  Fly   274 LRDKYE-----IPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMK 333
            .:|::.     :.|.|::|::.:|:|.||:|..|.:|.. .||||.::... :..||:.||::|.
Zfish   179 AQDEFSRSGWALNRKELKLIQTIGKGEFGDVMVGDYRGK-KVAVKCIKHDA-TAQAFVAEASVMT 241

  Fly   334 KFRHNRLVALYAVCSQEE-PIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLE 397
            :.|||.||.|..|..:|: .:|||.|||:||||:|:||......:..:.||..:..|...|||||
Zfish   242 QLRHNNLVQLLGVIVEEKGSLYIVTEYMAKGSLVDYLRSRGRTVIGGDRLINFSMDVCKAMEYLE 306

  Fly   398 SKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKS 462
            :...:||||||||||:.|:|:||:.||||.:..:..:    ..::.|||||:|||:...|||.||
Zfish   307 ANNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQ----DTAKLPVKWTSPEALREKKFSTKS 367

  Fly   463 DVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCW--DAVPE 525
            |||||||||.|::::|:||||.:..:||:..:|:|::|..|..  .|..:|.::.|||  |||  
Zfish   368 DVWSYGILLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDSPDG--CPPVVYDIMKQCWTLDAV-- 428

  Fly   526 KRPTFEFLNHYFESFSVTSEVPYR 549
            .||:|..|....:.. :|:|: ||
Zfish   429 VRPSFRDLREKLQDI-ITNEL-YR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 17/51 (33%)
SH2_Src_family 158..259 CDD:199827 38/106 (36%)
STYKc 285..537 CDD:214568 110/254 (43%)
PTKc_Src_like 289..538 CDD:270630 109/251 (43%)
cskNP_001071067.1 SH3_CSK 11..67 CDD:212703 20/63 (32%)
SH2_csk_like 78..175 CDD:198190 38/111 (34%)
PTKc_Csk 188..443 CDD:133213 112/264 (42%)
STYKc 195..440 CDD:214568 110/254 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.