Sequence 1: | NP_001286937.1 | Gene: | Src64B / 48973 | FlyBaseID: | FBgn0262733 | Length: | 553 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998200.1 | Gene: | grb2b / 406308 | ZFINID: | ZDB-GENE-040426-1975 | Length: | 217 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 59/212 - (27%) |
---|---|---|---|
Similarity: | 106/212 - (50%) | Gaps: | 43/212 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 VALYDYKSRDESDLSFMKGDRMEVI-DDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFF 164
Fly 165 ENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIA 229
Fly 230 TNQTFPSLQALVMAYSKENALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPR--SEIQLL---- 288
Fly 289 ----RKLG--RGNFGEV 299 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Src64B | NP_001286937.1 | SH3_Src_like | 99..150 | CDD:212779 | 13/49 (27%) |
SH2_Src_family | 158..259 | CDD:199827 | 31/100 (31%) | ||
STYKc | 285..537 | CDD:214568 | 8/25 (32%) | ||
PTKc_Src_like | 289..538 | CDD:270630 | 6/13 (46%) | ||
grb2b | NP_998200.1 | SH3_GRB2_N | 1..56 | CDD:212879 | 14/57 (25%) |
SH2_Grb2_like | 56..150 | CDD:199828 | 34/117 (29%) | ||
SH3_GRB2_C | 160..212 | CDD:212882 | 8/26 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |