DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Ack

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster


Alignment Length:340 Identity:115/340 - (33%)
Similarity:172/340 - (50%) Gaps:47/340 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PSLQALVMAYSKENALGLCH-----ILSR-------PCPKPQPQMWDLGPELRDKYE-------- 279
            |:::.|:.|..|:.|    |     |||:       |..|.|      ....|:..:        
  Fly    62 PAIRRLMEAVRKKKA----HQWRKNILSKLIGGGKQPSSKKQ------SSAARESSQGNGTQLTC 116

  Fly   280 -IPRSEIQLLRKLGRGNFGEVFYGKWRNS-----IDVAVKTLREGTMSTAA----FLQEAAIMKK 334
             |...:|.:..|||.|:||.|..|:|..|     |.||||.|:...::...    |.:|...|..
  Fly   117 LIHEKDITMGLKLGDGSFGVVRRGEWSASPAGKVIPVAVKVLKSDNLTQPGIIDDFFREVQAMHA 181

  Fly   335 FRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESK 399
            ..|..||.||.|. ..:|:.::.|...:|||||.||: ..|:.....:...:.|:.:||.|||.|
  Fly   182 LDHANLVRLYGVV-LSQPMMMITELAERGSLLDTLRK-QCRHTSLTIIWNWSVQIVTGMAYLEQK 244

  Fly   400 QLIHRDLAARNVLIGENNVAKICDFGLARVI--ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKS 462
            :.:|||||.||||:...|..||.||||.|.:  .||.|...:..:.|..|.|||::.:.:||..|
  Fly   245 RFLHRDLACRNVLLAAGNKIKIGDFGLMRALPQEDDCYVMSEHKKVPFPWCAPESLRFRQFSHAS 309

  Fly   463 DVWSYGILLMELFTYGQVPYPGMHSREVIENIER-GFRMPKPTNHYFPDNIYQLLLQCWDAVPEK 526
            |.|.:|:.|.|:|::|:.|:.|::..:::..|:| |.|:.:|  ...|.::|.::|||||..|.:
  Fly   310 DTWMFGVTLWEMFSFGEDPWVGLNGSQILRKIDREGERLHQP--DACPPDVYAMMLQCWDKTPAE 372

  Fly   527 RPTFEFLNHYFESFS 541
            ||||..|..|..|.|
  Fly   373 RPTFAALKEYLASMS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 9/35 (26%)
STYKc 285..537 CDD:214568 98/263 (37%)
PTKc_Src_like 289..538 CDD:270630 98/260 (38%)
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938 4/12 (33%)
PTKc_Ack_like 128..385 CDD:270636 98/260 (38%)
UBA_TNK1 1031..1070 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468362
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.