DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Fak

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001137718.1 Gene:Fak / 37233 FlyBaseID:FBgn0020440 Length:1500 Species:Drosophila melanogaster


Alignment Length:315 Identity:106/315 - (33%)
Similarity:161/315 - (51%) Gaps:41/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 PELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKW----------------------RNS------I 308
            |.:|: ||:.|:.|....|:|.|.||:|:.|.:                      ||:      |
  Fly   445 PTVRN-YELDRALITPSAKIGVGQFGDVYVGTYTLPKLGKGKNLAGNGKNSNSDQRNADSRPDVI 508

  Fly   309 DVAVKTLR--EGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLRE 371
            .||:||.:  :....|..||.||.||:||.|..::.|..:|| ..||:||.|....|.|..:|:.
  Fly   509 QVAIKTCKANDDPEKTENFLAEAYIMQKFDHPHIIRLIGICS-VMPIWIVMELAKLGELRAYLKT 572

  Fly   372 GDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYC 436
            ...|..| ..|:....|:::.:.|||||:.:|||:||||||:......|:.||||:|.::|..|.
  Fly   573 NSERLSH-GTLLKYCYQLSTALSYLESKKFVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYY 636

  Fly   437 PKQGS-RFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRM 500
            ....: ..|:||.:||:|.:.:|:..||||.:|:.:.|:...|..|:.|:.:.:||..:|.|.|:
  Fly   637 HSTPTVALPIKWMSPESINFRRFTTASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERL 701

  Fly   501 PKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV-----TSEVPYRE 550
            |.|.|  .|..:|.|:.|||...|.|||.|:.:........:     :||...||
  Fly   702 PLPPN--CPPRLYSLMSQCWAYEPLKRPNFKRIKETLHEILIEDSINSSETLKRE 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 97/282 (34%)
PTKc_Src_like 289..538 CDD:270630 96/279 (34%)
FakNP_001137718.1 B41 24..267 CDD:214604
FERM_B-lobe 152..257 CDD:271216
FERM_C_FAK1 263..394 CDD:270011
PTKc_FAK 450..744 CDD:133187 100/297 (34%)
Pkinase_Tyr 462..736 CDD:285015 96/277 (35%)
Focal_AT 1249..1376 CDD:281606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468366
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.