DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and drk

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster


Alignment Length:119 Identity:38/119 - (31%)
Similarity:70/119 - (58%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VALYDYKSRDESDLSFMKGDRMEVID-DTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFF 164
            :|.:|:.:..:.:|||.|...::::: :.:|:|:|..  ...:|||||.|::    .:.:.||::
  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI
----EMKNHDWYY 62

  Fly   165 ENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRI 218
            ..:.|.:|:|||  .....|.||:|.||.:|..:||||| ..||    |:|:::
  Fly    63 GRITRADAEKLL--SNKHEGAFLIRISESSPGDFSLSVK-CPDG----VQHFKV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 14/49 (29%)
SH2_Src_family 158..259 CDD:199827 23/61 (38%)
STYKc 285..537 CDD:214568
PTKc_Src_like 289..538 CDD:270630
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 15/50 (30%)
SH2_Grb2_like 56..149 CDD:199828 23/61 (38%)
SH3_GRB2_like_C 156..208 CDD:212739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.