DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Ack-like

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster


Alignment Length:416 Identity:131/416 - (31%)
Similarity:191/416 - (45%) Gaps:52/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSE 192
            |||:..:..|....:   :.:...|:.:....||..|..:.|.|..:|....|           :
  Fly    13 TESELQQYYNAVKNE---LKITNAAQFKYAADEDLRFIGLSRPEIRRLRKFYE-----------K 63

  Fly   193 HNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKENALGLCHILS 257
            |.|:.|...:|......|..||.   :....||..:|.:.:  |..|.....:|..|       |
  Fly    64 HFPHSYLSKIKRLLQAPGTMVKR---EEAPGGGSQVALDGS--SASACSSLAAKNGA-------S 116

  Fly   258 RPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNS---IDVAVKTL-REG 318
            .|...|           .:|:.||...|.:.::||.|.||.|..|.|.|.   |.||:|.| ||.
  Fly   117 SPSKVP-----------NNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRER 170

  Fly   319 TMST-AAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGR--YLHFE 380
            ..|. ..||:|||||....|..:|.||.|....:.:.:|.|.....|||:.|::...|  :|...
  Fly   171 MQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIP 235

  Fly   381 DLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARV--IADDEYCP--KQGS 441
            .|...|.|:.:||.|||.|:||||||||||:|:...:..||.||||:|.  :..|.|..  ....
  Fly   236 TLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNL 300

  Fly   442 RFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIE--RGFRMPKPT 504
            :.|:.|.|||.|.|.:|:..||||::|:.|.|:|:||..|:..:...:::|.|:  ...|:.:| 
  Fly   301 KLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQP- 364

  Fly   505 NHYFPDNIYQLLLQCWDAVPEKRPTF 530
             ...|...|.|:::||.....|||.|
  Fly   365 -DCCPSEYYTLMMKCWQDDAAKRPRF 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 4/21 (19%)
SH2_Src_family 158..259 CDD:199827 22/100 (22%)
STYKc 285..537 CDD:214568 99/259 (38%)
PTKc_Src_like 289..538 CDD:270630 98/255 (38%)
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 12/65 (18%)
STYKc 133..396 CDD:214568 99/259 (38%)
PTKc_Ack_like 137..398 CDD:270636 98/255 (38%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.