DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Itk

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001102295.2 Gene:Itk / 363577 RGDID:1311618 Length:620 Species:Rattus norvegicus


Alignment Length:480 Identity:178/480 - (37%)
Similarity:263/480 - (54%) Gaps:39/480 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDRMEVID 126
            ||:.|.|           ....|..|           :|:|||||::.|..:|:..:.:...::|
  Rat   160 TPEDNRR-----------SFQEPEET-----------LVIALYDYQTNDPQELALRRDEEYYLLD 202

  Fly   127 DTESDWWRVVNLTTRQEGLIPLNFVAEE--RSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVR 189
            .:|..||||.: ....||..|.:::.|:  .|:.:.:|:.:::.|.:|:|||| :....|.|:||
  Rat   203 SSEIHWWRVQD-KNGHEGYAPSSYLVEKSPNSLETYEWYNKSISRDKAEKLLL-DTGKEGAFMVR 265

  Fly   190 PSEHNPNGYSLSV--KDWEDGRGYHVKHYRIKPLDNG--GYYIATNQTFPSLQALVMAYSKENAL 250
            .| ..|..|::||  |.........:|||.||..::.  .||:|....|.|:..|:. |.:.|..
  Rat   266 DS-RTPGTYTVSVFTKAIISENNPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQ-YHQYNGG 328

  Fly   251 GLCHILSRP-CPKPQPQMWDLGPELR-DKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVK 313
            ||...|..| |...|......|  || .|:.|..||:..::::|.|.||.|..|.|.|...||:|
  Rat   329 GLVTRLRYPVCSWRQKAPVTAG--LRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIK 391

  Fly   314 TLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLH 378
            |::||.||...|::||.:|.|..|.:||.||.||.::.||.:|.|:|..|.|.|:||...|.:. 
  Rat   392 TIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFA- 455

  Fly   379 FEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRF 443
            .|.|:.:...|..||.|||...:|||||||||.|:|||.|.|:.|||:.|.:.||:|....|::|
  Rat   456 AETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKF 520

  Fly   444 PVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYF 508
            ||||.:||...:.::|.||||||:|:|:.|:|:.|::||....:.||:|:|..|||:.||  ...
  Rat   521 PVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKP--RLA 583

  Fly   509 PDNIYQLLLQCWDAVPEKRPTFEFL 533
            ..::||::..||...||.||.|..|
  Rat   584 SPHVYQVMNHCWKEKPEDRPPFSRL 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 17/50 (34%)
SH2_Src_family 158..259 CDD:199827 33/104 (32%)
STYKc 285..537 CDD:214568 110/249 (44%)
PTKc_Src_like 289..538 CDD:270630 110/245 (45%)
ItkNP_001102295.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.