DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and CG10702

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:276 Identity:54/276 - (19%)
Similarity:93/276 - (33%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IDDTESDWWRVVNLTT--RQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFL 187
            :||.:.|...||.|.|  ..|       ..|.....||..:.:..|......||...:....:..
  Fly   538 LDDLQPDTRYVVLLRTFGNDE-------AHEAYEARSELTYVQTELDIPKPPLLELVKKTDSSLT 595

  Fly   188 VRPSEHNPNGYSLSVKDWEDGRGY-HVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKENALG 251
            |:.:.|:...:.|:|.:..|.:.| ..::|..:|     .|:..:...|..    |||...:.  
  Fly   596 VQMASHDHVSFLLTVFELSDDQDYIEQRNYCHQP-----SYVWQDMDGPRW----MAYEDYDD-- 649

  Fly   252 LCHILSRPCPKPQPQMWD--LGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKT 314
             |      |.:...|..|  ...::|::|.....:.:..|:|..              .:|::..
  Fly   650 -C------CAQKAEQFEDSRFIADMREQYRCTLDDREQCRRLAH--------------TEVSLPQ 693

  Fly   315 LREGTMSTAAFLQEAAIMKKFRHNRLVALYAV---------CSQEEPIYIVQEYMSKGSLLD--- 367
            ||....:|.   .|...:.::|      |||:         ||....:|....|.....||.   
  Fly   694 LRLPGNTTE---YELKALHRYR------LYALQLQACNPLGCSSHTTLYGRTNYTMGADLLTQLY 749

  Fly   368 --FLREGDGRYLHFED 381
              .:.|.|...:.||:
  Fly   750 ACHIPEMDKYIMRFEE 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 8/26 (31%)
SH2_Src_family 158..259 CDD:199827 19/101 (19%)
STYKc 285..537 CDD:214568 21/111 (19%)
PTKc_Src_like 289..538 CDD:270630 21/107 (20%)
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.