DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Abl2

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_038946666.1 Gene:Abl2 / 304883 RGDID:1590898 Length:1188 Species:Rattus norvegicus


Alignment Length:474 Identity:192/474 - (40%)
Similarity:277/474 - (58%) Gaps:38/474 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFE 165
            |||||:.:..::.||..||:::.|:...::..|..|. :...:|.:|.|::....|:....|:..
  Rat   113 VALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVR-SKNGQGWVPSNYITP
VNSLEKHSWYHG 176

  Fly   166 NVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIAT 230
            .|.|..|:.||.:..|  |:||||.||.:|...|:|::  .:||.|   ||||....:...|:..
  Rat   177 PVSRSAAEYLLSSLIN--GSFLVRESESSPGQLSISLR--YEGRVY---HYRINTTTDSKVYVTA 234

  Fly   231 NQTFPSLQALVMAYSKENALGLCHILSRPCPK-PQPQMWDLGPELRDKYEIPRSEIQLLRKLGRG 294
            ...|.:|..||..:|.. |.||...|..|.|| .:|.::.:.| :.||:|:.|::|.:..|||.|
  Rat   235 ESRFSTLAELVHHHSTV-ADGLVTTLHYP
APKCNKPTVYGVSP-IHDKWEMERTDITMKHKLGGG 297

  Fly   295 NFGEVFYGKWRN-SIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQE 358
            .:|||:.|.|:. |:.||||||:|.||....||:|||:||:.:|..||.|..||:.|.|.|||.|
  Rat   298 QYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTE 362

  Fly   359 YMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICD 423
            ||..|:|||:|||.....:....|:|:|||::|.|||||.|..|||||||||.|:|||:|.|:.|
  Rat   363 YMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVAD 427

  Fly   424 FGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSR 488
            |||:|::..|.|....|::||:||||||::.|..||||||||::|:||.|:.|||..||||:...
  Rat   428 FGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLS 492

  Fly   489 EVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESF------------- 540
            :|.:.:|:|:||.:|..  .|..:|:|:..||...|..||:|...:..||:.             
  Rat   493 QVYDLLEKGYRMEQPEG--CPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEDFVFF 555

  Fly   541 -----------SVTSEVPY 548
                       |.:|.|||
  Rat   556 TEVAEELGRTASSSSVVPY 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 14/48 (29%)
SH2_Src_family 158..259 CDD:199827 34/100 (34%)
STYKc 285..537 CDD:214568 126/252 (50%)
PTKc_Src_like 289..538 CDD:270630 125/249 (50%)
Abl2XP_038946666.1 SH3_Abl 111..164 CDD:212784 15/51 (29%)
SH2_ABL 169..262 CDD:198189 34/100 (34%)
PTKc_Abl 281..543 CDD:270645 130/263 (49%)
FABD 1069..1188 CDD:197885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.