DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and GRB2

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_002077.1 Gene:GRB2 / 2885 HGNCID:4566 Length:217 Species:Homo sapiens


Alignment Length:209 Identity:59/209 - (28%)
Similarity:105/209 - (50%) Gaps:43/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VALYDYKSRDESDLSFMKGDRMEVI-DDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFF 164
            :|.||:|:..:.:|||.:||.::|: ::.:.:|::..  ...::|.||.|::    .:....|||
Human     4 IAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAE--LNGKDGFIPKNYI----EMKPHPWFF 62

  Fly   165 ENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIA 229
            ..:.|.:|:: :|:::...|.||:|.||..|..:|||||...|     |:|:::. .|..|.|..
Human    63 GKIPRAKAEE-MLSKQRHDGAFLIRESESAPGDFSLSVKFGND-----VQHFKVL-RDGAGKYFL 120

  Fly   230 TNQTFPSLQALVMAYSKENALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPR--SEIQLL---- 288
            ....|.||..|| .|.:..:      :||     ..|::     |||..::|:  :.:|.|    
Human   121 WVVKFNSLNELV-DYHRSTS------VSR-----NQQIF-----LRD
IEQVPQQPTYVQALFDFD 168

  Fly   289 ----RKLG--RGNF 296
                .:||  ||:|
Human   169 PQEDGELGFRRGDF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 14/49 (29%)
SH2_Src_family 158..259 CDD:199827 31/100 (31%)
STYKc 285..537 CDD:214568 7/22 (32%)
PTKc_Src_like 289..538 CDD:270630 5/10 (50%)
GRB2NP_002077.1 SH3_GRB2_N 1..56 CDD:212879 15/57 (26%)
SH2_Grb2_like 56..150 CDD:199828 34/117 (29%)
SH3_GRB2_C 160..212 CDD:212882 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.