powered by:
Protein Alignment Src64B and skb5
DIOPT Version :9
Sequence 1: | NP_001286937.1 |
Gene: | Src64B / 48973 |
FlyBaseID: | FBgn0262733 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_588016.1 |
Gene: | skb5 / 2539237 |
PomBaseID: | SPCC24B10.13 |
Length: | 140 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 54 |
Identity: | 16/54 - (29%) |
Similarity: | 30/54 - (55%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 VALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEE 154
|||||::...:::|.|..|.|:.::.::...|....:..:.:.||:|..||..|
pombe 86 VALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFVKLE 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000006 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.